BLASTX nr result
ID: Astragalus23_contig00031212
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus23_contig00031212 (263 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003621766.2| F-box protein interaction domain protein [Me... 55 2e-09 ref|XP_003623087.2| F-box protein interaction domain protein [Me... 57 8e-09 ref|XP_003591487.2| F-box protein interaction domain protein [Me... 47 1e-08 ref|XP_003623082.2| F-box protein interaction domain protein [Me... 56 2e-08 ref|XP_013449049.1| F-box protein interaction domain protein [Me... 54 2e-08 ref|XP_003624064.1| F-box protein interaction domain protein [Me... 52 3e-08 dbj|GAU40142.1| hypothetical protein TSUD_163110 [Trifolium subt... 47 3e-08 gb|PNY16674.1| F-box/kelch-repeat protein [Trifolium pratense] 52 4e-08 ref|XP_013448741.1| F-box protein interaction domain protein [Me... 49 4e-08 ref|XP_003601406.1| F-box protein interaction domain protein [Me... 59 4e-08 ref|XP_004514279.1| PREDICTED: F-box/kelch-repeat protein At3g23... 49 5e-08 ref|XP_003623093.1| F-box protein interaction domain protein [Me... 54 5e-08 ref|XP_013442609.1| F-box protein interaction domain protein [Me... 53 8e-08 ref|XP_013442605.1| F-box protein interaction domain protein [Me... 54 1e-07 gb|PNY11321.1| hypothetical protein L195_g007925, partial [Trifo... 49 1e-07 dbj|GAU18259.1| hypothetical protein TSUD_176010 [Trifolium subt... 45 2e-07 dbj|GAU18258.1| hypothetical protein TSUD_176000 [Trifolium subt... 47 2e-07 ref|XP_003623090.1| F-box protein interaction domain protein [Me... 52 2e-07 ref|XP_012568752.1| PREDICTED: F-box/kelch-repeat protein At3g23... 48 2e-07 ref|XP_003619473.1| F-box protein interaction domain protein [Me... 48 2e-07 >ref|XP_003621766.2| F-box protein interaction domain protein [Medicago truncatula] gb|AES77984.2| F-box protein interaction domain protein [Medicago truncatula] Length = 423 Score = 55.5 bits (132), Expect(2) = 2e-09 Identities = 25/50 (50%), Positives = 36/50 (72%), Gaps = 1/50 (2%) Frame = -1 Query: 257 WFRFWNPATREVSEILGNFPNHIDFGV-CFHYMFGYDRSSSTYKLVTLHY 111 W RFWNPATR++S+ LG+F + D+G + ++F YD S+ YK+V LHY Sbjct: 150 WLRFWNPATRKISDRLGSF-DDFDYGSNSWRFVFCYDNSTDYYKVVALHY 198 Score = 33.9 bits (76), Expect(2) = 2e-09 Identities = 14/25 (56%), Positives = 17/25 (68%) Frame = -3 Query: 75 PRTDVKIFSCGDNVWRLIHSLPLVP 1 P +V IF+ GDNVWR I +L VP Sbjct: 205 PVVEVSIFTLGDNVWRTIQTLSFVP 229 >ref|XP_003623087.2| F-box protein interaction domain protein [Medicago truncatula] gb|AES79305.2| F-box protein interaction domain protein [Medicago truncatula] Length = 389 Score = 57.4 bits (137), Expect(2) = 8e-09 Identities = 27/49 (55%), Positives = 33/49 (67%) Frame = -1 Query: 263 ENWFRFWNPATREVSEILGNFPNHIDFGVCFHYMFGYDRSSSTYKLVTL 117 E W RFWNPATR +S+ LG++P DF F FGYD S+ TYK+V L Sbjct: 139 EMWLRFWNPATRAISDKLGHYP--ADFTGGFEVAFGYDNSTDTYKVVYL 185 Score = 30.0 bits (66), Expect(2) = 8e-09 Identities = 12/17 (70%), Positives = 13/17 (76%) Frame = -3 Query: 57 IFSCGDNVWRLIHSLPL 7 +FS GDNVWR I S PL Sbjct: 192 VFSLGDNVWRNIESFPL 208 >ref|XP_003591487.2| F-box protein interaction domain protein [Medicago truncatula] gb|AES61738.2| F-box protein interaction domain protein [Medicago truncatula] Length = 412 Score = 47.4 bits (111), Expect(2) = 1e-08 Identities = 24/51 (47%), Positives = 32/51 (62%) Frame = -1 Query: 263 ENWFRFWNPATREVSEILGNFPNHIDFGVCFHYMFGYDRSSSTYKLVTLHY 111 E WFR WNPATR+ S+ +G F D G+ F + FG D S+ T+K+V Y Sbjct: 133 EYWFRLWNPATRKTSQKIGCF---CDSGI-FVFDFGCDNSTETFKVVASRY 179 Score = 39.7 bits (91), Expect(2) = 1e-08 Identities = 16/23 (69%), Positives = 19/23 (82%) Frame = -3 Query: 69 TDVKIFSCGDNVWRLIHSLPLVP 1 TDV++FS GDNVWR I S P+VP Sbjct: 188 TDVRVFSLGDNVWRNIESFPVVP 210 >ref|XP_003623082.2| F-box protein interaction domain protein [Medicago truncatula] gb|AES79300.2| F-box protein interaction domain protein [Medicago truncatula] Length = 395 Score = 55.8 bits (133), Expect(2) = 2e-08 Identities = 25/50 (50%), Positives = 33/50 (66%) Frame = -1 Query: 263 ENWFRFWNPATREVSEILGNFPNHIDFGVCFHYMFGYDRSSSTYKLVTLH 114 E W RFWNPATR +S+ LG+ P+ + + FGYD S+ TYK+V LH Sbjct: 139 EMWLRFWNPATRTISDKLGHSPDAVS---SYQMEFGYDNSTDTYKVVYLH 185 Score = 30.0 bits (66), Expect(2) = 2e-08 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = -3 Query: 60 KIFSCGDNVWRLIHSLPL 7 ++FS GDNVWR I S P+ Sbjct: 189 RVFSLGDNVWRNIESFPI 206 >ref|XP_013449049.1| F-box protein interaction domain protein [Medicago truncatula] gb|KEH23076.1| F-box protein interaction domain protein [Medicago truncatula] Length = 395 Score = 53.5 bits (127), Expect(2) = 2e-08 Identities = 27/54 (50%), Positives = 36/54 (66%), Gaps = 7/54 (12%) Frame = -1 Query: 263 ENWFRFWNPATREVSEILGNF----PNHID--FGV-CFHYMFGYDRSSSTYKLV 123 +NW RFWNPATR S+ LG+F P D +G+ C+ + FGYD S+ TYK+V Sbjct: 127 KNWLRFWNPATRTSSKNLGSFRYRTPRRYDNSYGLSCYKFSFGYDASTLTYKVV 180 Score = 32.3 bits (72), Expect(2) = 2e-08 Identities = 13/21 (61%), Positives = 15/21 (71%) Frame = -3 Query: 63 VKIFSCGDNVWRLIHSLPLVP 1 VKIF+ GDN WR I S P+ P Sbjct: 195 VKIFNLGDNCWRNIQSFPIFP 215 >ref|XP_003624064.1| F-box protein interaction domain protein [Medicago truncatula] gb|AES80282.1| F-box protein interaction domain protein [Medicago truncatula] Length = 433 Score = 52.4 bits (124), Expect(2) = 3e-08 Identities = 28/57 (49%), Positives = 32/57 (56%), Gaps = 8/57 (14%) Frame = -1 Query: 257 WFRFWNPATREVSEILGNF-------PNHID-FGVCFHYMFGYDRSSSTYKLVTLHY 111 WFR WNPATR S ILGNF P D F + + FG D S+STYK+V Y Sbjct: 143 WFRLWNPATRTTSPILGNFFIFHNYSPEKPDWFDGYYKFSFGCDNSTSTYKVVAARY 199 Score = 33.1 bits (74), Expect(2) = 3e-08 Identities = 14/24 (58%), Positives = 18/24 (75%) Frame = -3 Query: 72 RTDVKIFSCGDNVWRLIHSLPLVP 1 R++V+I S GDNVWR I S P+ P Sbjct: 205 RSNVRILSLGDNVWRDIESFPVDP 228 >dbj|GAU40142.1| hypothetical protein TSUD_163110 [Trifolium subterraneum] Length = 397 Score = 47.4 bits (111), Expect(2) = 3e-08 Identities = 23/44 (52%), Positives = 31/44 (70%), Gaps = 2/44 (4%) Frame = -1 Query: 248 FWNPATREVSEILGN--FPNHIDFGVCFHYMFGYDRSSSTYKLV 123 FWNPAT+ S+ LG+ + N DF + FH+ FGYD S+ TYK+V Sbjct: 149 FWNPATKTTSKKLGSLCYSNWPDFDI-FHFTFGYDASTRTYKVV 191 Score = 38.1 bits (87), Expect(2) = 3e-08 Identities = 14/24 (58%), Positives = 19/24 (79%) Frame = -3 Query: 72 RTDVKIFSCGDNVWRLIHSLPLVP 1 +++VK+FS GDN WR IHS P +P Sbjct: 203 KSEVKVFSVGDNCWRNIHSFPSIP 226 >gb|PNY16674.1| F-box/kelch-repeat protein [Trifolium pratense] Length = 426 Score = 51.6 bits (122), Expect(2) = 4e-08 Identities = 27/58 (46%), Positives = 35/58 (60%) Frame = -1 Query: 263 ENWFRFWNPATREVSEILGNFPNHIDFGVCFHYMFGYDRSSSTYKLVTLHY*IASRLT 90 E W R WNPATRE+SE +G F ++ DFG + FG D + T+K V Y I +LT Sbjct: 146 EYWLRLWNPATREISEKIGCFIDYRDFG----FNFGCDNPTGTFKAVASRY-IPDKLT 198 Score = 33.5 bits (75), Expect(2) = 4e-08 Identities = 13/23 (56%), Positives = 18/23 (78%) Frame = -3 Query: 69 TDVKIFSCGDNVWRLIHSLPLVP 1 +DV++FS +NVWR I S P+VP Sbjct: 199 SDVRVFSFDENVWRNIQSFPVVP 221 >ref|XP_013448741.1| F-box protein interaction domain protein [Medicago truncatula] gb|KEH22768.1| F-box protein interaction domain protein [Medicago truncatula] Length = 406 Score = 48.9 bits (115), Expect(2) = 4e-08 Identities = 22/48 (45%), Positives = 32/48 (66%) Frame = -1 Query: 257 WFRFWNPATREVSEILGNFPNHIDFGVCFHYMFGYDRSSSTYKLVTLH 114 W RFWNPATR++S+ LG + ++FGYD S++TYK+V L+ Sbjct: 145 WLRFWNPATRKISDKLGYLHADNYRRNSWMFVFGYDDSTNTYKIVALN 192 Score = 36.2 bits (82), Expect(2) = 4e-08 Identities = 20/41 (48%), Positives = 24/41 (58%), Gaps = 1/41 (2%) Frame = -3 Query: 120 ITLLNCFEVDLPETH-PRTDVKIFSCGDNVWRLIHSLPLVP 1 I LNC +V P ++ IFS GDNVWR I SL +VP Sbjct: 188 IVALNCEDVLRNVLRKPEVNMSIFSLGDNVWRSIKSLNIVP 228 >ref|XP_003601406.1| F-box protein interaction domain protein [Medicago truncatula] gb|AES71657.1| F-box protein interaction domain protein [Medicago truncatula] Length = 450 Score = 58.9 bits (141), Expect = 4e-08 Identities = 34/77 (44%), Positives = 42/77 (54%) Frame = -1 Query: 257 WFRFWNPATREVSEILGNFPNHIDFGVCFHYMFGYDRSSSTYKLVTLHY*IASRLTYRKL 78 WF FWNPATR +SE LG F + F + FG DR + TYK+V LH R R+L Sbjct: 138 WFCFWNPATRTISEDLGFFVDSKPLLGPFKFSFGCDRLTGTYKVVALH---TGRNEEREL 194 Query: 77 IREPM*KFLVVVIMFGD 27 E + + V V FGD Sbjct: 195 ENESLWRSKVAVFSFGD 211 >ref|XP_004514279.1| PREDICTED: F-box/kelch-repeat protein At3g23880-like [Cicer arietinum] ref|XP_004514280.1| PREDICTED: F-box/kelch-repeat protein At3g23880-like [Cicer arietinum] ref|XP_012575281.1| PREDICTED: F-box/kelch-repeat protein At3g23880-like [Cicer arietinum] ref|XP_012575282.1| PREDICTED: F-box/kelch-repeat protein At3g23880-like [Cicer arietinum] ref|XP_012575283.1| PREDICTED: F-box/kelch-repeat protein At3g23880-like [Cicer arietinum] Length = 426 Score = 48.5 bits (114), Expect(2) = 5e-08 Identities = 25/50 (50%), Positives = 30/50 (60%), Gaps = 1/50 (2%) Frame = -1 Query: 263 ENWFRFWNPATREVSEILGNF-PNHIDFGVCFHYMFGYDRSSSTYKLVTL 117 E W RFWNPA ++S LG F N + F + FGYD SS TYK+V L Sbjct: 139 EIWLRFWNPAVGKISYKLGYFVDNVLGLYTHFKFAFGYDISSETYKVVLL 188 Score = 36.2 bits (82), Expect(2) = 5e-08 Identities = 15/30 (50%), Positives = 19/30 (63%) Frame = -3 Query: 90 LPETHPRTDVKIFSCGDNVWRLIHSLPLVP 1 L E T+V++FS G NVWR I + P VP Sbjct: 190 LDEARNSTEVRVFSLGHNVWRTIQNFPAVP 219 >ref|XP_003623093.1| F-box protein interaction domain protein [Medicago truncatula] gb|AES79311.1| F-box protein interaction domain protein [Medicago truncatula] Length = 407 Score = 53.5 bits (127), Expect(2) = 5e-08 Identities = 25/47 (53%), Positives = 30/47 (63%) Frame = -1 Query: 263 ENWFRFWNPATREVSEILGNFPNHIDFGVCFHYMFGYDRSSSTYKLV 123 ENW RFWNPATR +SE L G F++ FGYD S+ TYK+V Sbjct: 153 ENWLRFWNPATRTISEKLDGDDG---LGFPFNFTFGYDNSTETYKVV 196 Score = 31.2 bits (69), Expect(2) = 5e-08 Identities = 13/26 (50%), Positives = 19/26 (73%) Frame = -3 Query: 81 THPRTDVKIFSCGDNVWRLIHSLPLV 4 T T+V++FS G+NVWR I + P+V Sbjct: 199 TPKTTNVRVFSLGNNVWRDIQNSPVV 224 >ref|XP_013442609.1| F-box protein interaction domain protein [Medicago truncatula] gb|KEH16634.1| F-box protein interaction domain protein [Medicago truncatula] Length = 398 Score = 53.1 bits (126), Expect(2) = 8e-08 Identities = 22/49 (44%), Positives = 36/49 (73%), Gaps = 2/49 (4%) Frame = -1 Query: 257 WFRFWNPATREVSEILGN--FPNHIDFGVCFHYMFGYDRSSSTYKLVTL 117 WFRFWNPATR++S++LG+ + N + + ++FGY+ + TYK+V+L Sbjct: 146 WFRFWNPATRKISDVLGSDVYFNDMHISRFYVFVFGYESLTDTYKVVSL 194 Score = 30.8 bits (68), Expect(2) = 8e-08 Identities = 12/19 (63%), Positives = 14/19 (73%) Frame = -3 Query: 66 DVKIFSCGDNVWRLIHSLP 10 +VK+FS GDNVWR I P Sbjct: 200 EVKVFSLGDNVWRHIRRFP 218 >ref|XP_013442605.1| F-box protein interaction domain protein [Medicago truncatula] gb|KEH16630.1| F-box protein interaction domain protein [Medicago truncatula] Length = 395 Score = 54.3 bits (129), Expect(2) = 1e-07 Identities = 24/49 (48%), Positives = 34/49 (69%), Gaps = 2/49 (4%) Frame = -1 Query: 257 WFRFWNPATREVSEILGN--FPNHIDFGVCFHYMFGYDRSSSTYKLVTL 117 WFRFWNPATR +S++LG+ + N + ++FGYD S+ TYK+V L Sbjct: 143 WFRFWNPATRNISQVLGSDVYFNDMHISRFTVFVFGYDSSTDTYKVVAL 191 Score = 29.3 bits (64), Expect(2) = 1e-07 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = -3 Query: 66 DVKIFSCGDNVWRLIHSLP 10 ++++FS GDNVWR I P Sbjct: 197 EMRVFSLGDNVWRYIQRFP 215 >gb|PNY11321.1| hypothetical protein L195_g007925, partial [Trifolium pratense] Length = 394 Score = 48.5 bits (114), Expect(2) = 1e-07 Identities = 25/58 (43%), Positives = 32/58 (55%) Frame = -1 Query: 263 ENWFRFWNPATREVSEILGNFPNHIDFGVCFHYMFGYDRSSSTYKLVTLHY*IASRLT 90 E W R WNPATRE+SE G F F++ FG D S+ T+K+V Y + R T Sbjct: 33 EYWLRLWNPATREISENFGCFIGSRG----FNFNFGCDNSTGTFKVVASRYILDQRTT 86 Score = 35.0 bits (79), Expect(2) = 1e-07 Identities = 14/23 (60%), Positives = 18/23 (78%) Frame = -3 Query: 69 TDVKIFSCGDNVWRLIHSLPLVP 1 TDV++ S GD+VWR I S P+VP Sbjct: 86 TDVRVLSFGDSVWRNIESFPVVP 108 >dbj|GAU18259.1| hypothetical protein TSUD_176010 [Trifolium subterraneum] Length = 409 Score = 45.1 bits (105), Expect(2) = 2e-07 Identities = 22/50 (44%), Positives = 32/50 (64%), Gaps = 3/50 (6%) Frame = -1 Query: 257 WFRFWNPATREVSEILGNFPNHIDFGVCFHY---MFGYDRSSSTYKLVTL 117 W FWNPATR++S+ LG+ H + + Y +FGYD S+ TYK+V + Sbjct: 148 WLCFWNPATRKISDKLGS-DYHYNVKYTWKYSKFVFGYDNSTDTYKVVAV 196 Score = 37.7 bits (86), Expect(2) = 2e-07 Identities = 14/33 (42%), Positives = 21/33 (63%) Frame = -3 Query: 99 EVDLPETHPRTDVKIFSCGDNVWRLIHSLPLVP 1 + D + +T V++FS GDN+WR I P+VP Sbjct: 198 QTDNNDPQSKTKVRVFSLGDNIWRTIQGFPVVP 230 >dbj|GAU18258.1| hypothetical protein TSUD_176000 [Trifolium subterraneum] Length = 400 Score = 47.4 bits (111), Expect(2) = 2e-07 Identities = 22/52 (42%), Positives = 33/52 (63%), Gaps = 4/52 (7%) Frame = -1 Query: 257 WFRFWNPATREVSEILGN----FPNHIDFGVCFHYMFGYDRSSSTYKLVTLH 114 W RFWNPATR++S+ LG+ N + ++FGYD S+ TYK+V ++ Sbjct: 139 WLRFWNPATRKISDKLGSDFYFDDNRYGWKYDSKFVFGYDDSTDTYKVVAVN 190 Score = 35.4 bits (80), Expect(2) = 2e-07 Identities = 14/20 (70%), Positives = 17/20 (85%) Frame = -3 Query: 63 VKIFSCGDNVWRLIHSLPLV 4 V++FS GDNVWR I SLP+V Sbjct: 196 VRVFSLGDNVWRTIQSLPMV 215 >ref|XP_003623090.1| F-box protein interaction domain protein [Medicago truncatula] gb|AES79308.1| F-box protein interaction domain protein [Medicago truncatula] Length = 385 Score = 52.4 bits (124), Expect(2) = 2e-07 Identities = 25/47 (53%), Positives = 29/47 (61%) Frame = -1 Query: 263 ENWFRFWNPATREVSEILGNFPNHIDFGVCFHYMFGYDRSSSTYKLV 123 ENW RFWNPATR +SE F G +Y FGYD S+ TYK+V Sbjct: 133 ENWLRFWNPATRIISE---KFHGDDGLGFPCNYTFGYDNSTETYKVV 176 Score = 30.4 bits (67), Expect(2) = 2e-07 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = -3 Query: 81 THPRTDVKIFSCGDNVWRLIHSLPLV 4 T T+V++FS G NVWR I P++ Sbjct: 179 TRKTTNVRVFSLGVNVWRNIQDSPMI 204 >ref|XP_012568752.1| PREDICTED: F-box/kelch-repeat protein At3g23880-like [Cicer arietinum] Length = 246 Score = 48.1 bits (113), Expect(2) = 2e-07 Identities = 22/48 (45%), Positives = 28/48 (58%) Frame = -1 Query: 257 WFRFWNPATREVSEILGNFPNHIDFGVCFHYMFGYDRSSSTYKLVTLH 114 W RFWNPATR +SE LG++ FGYD S+ TYK+V + Sbjct: 64 WLRFWNPATRIISEKLGSYNQPRQHYKRLRCTFGYDNSTHTYKVVAFN 111 Score = 34.7 bits (78), Expect(2) = 2e-07 Identities = 13/22 (59%), Positives = 18/22 (81%) Frame = -3 Query: 66 DVKIFSCGDNVWRLIHSLPLVP 1 ++K+F+ GDN WR I SLP+VP Sbjct: 114 EIKVFTLGDNNWRNIQSLPVVP 135 >ref|XP_003619473.1| F-box protein interaction domain protein [Medicago truncatula] gb|AES75691.1| F-box protein interaction domain protein [Medicago truncatula] Length = 447 Score = 47.8 bits (112), Expect(2) = 2e-07 Identities = 23/45 (51%), Positives = 27/45 (60%) Frame = -1 Query: 257 WFRFWNPATREVSEILGNFPNHIDFGVCFHYMFGYDRSSSTYKLV 123 WF WNPATR +SE LG F + F + FG D S+ TYKLV Sbjct: 139 WFCLWNPATRTISEELGTFRCYNTSSETFKFGFGCDISTGTYKLV 183 Score = 34.7 bits (78), Expect(2) = 2e-07 Identities = 14/24 (58%), Positives = 17/24 (70%) Frame = -3 Query: 72 RTDVKIFSCGDNVWRLIHSLPLVP 1 R+ V+IFS DN WR I S PL+P Sbjct: 199 RSQVRIFSLSDNCWRNIESFPLIP 222