BLASTX nr result
ID: Astragalus23_contig00031132
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus23_contig00031132 (535 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_013463012.1| WPP domain associated protein [Medicago trun... 124 1e-29 ref|XP_012569941.1| PREDICTED: WPP domain-associated protein iso... 121 2e-28 ref|XP_004486461.1| PREDICTED: WPP domain-associated protein iso... 121 2e-28 ref|XP_017436841.1| PREDICTED: WPP domain-associated protein [Vi... 120 3e-28 ref|XP_014518810.1| WPP domain-associated protein [Vigna radiata... 120 3e-28 ref|XP_019420011.1| PREDICTED: WPP domain-associated protein-lik... 120 4e-28 ref|XP_006586840.1| PREDICTED: WPP domain-associated protein-lik... 118 1e-27 gb|KYP62490.1| WPP domain-associated protein [Cajanus cajan] 118 2e-27 ref|XP_020220749.1| WPP domain-associated protein [Cajanus cajan] 118 2e-27 gb|KHN14327.1| WPP domain-associated protein [Glycine soja] 117 4e-27 ref|XP_003547328.1| PREDICTED: WPP domain-associated protein-lik... 117 5e-27 ref|XP_019577352.1| PREDICTED: WPP domain-associated protein-lik... 114 1e-26 ref|XP_008225599.1| PREDICTED: WPP domain-associated protein [Pr... 115 2e-26 ref|XP_018462945.1| PREDICTED: WPP domain-associated protein-lik... 115 2e-26 ref|XP_013734276.1| WPP domain-associated protein-like [Brassica... 115 2e-26 ref|XP_013702165.1| WPP domain-associated protein-like [Brassica... 115 2e-26 ref|XP_009132999.1| PREDICTED: WPP domain-associated protein [Br... 115 2e-26 ref|XP_007147479.1| hypothetical protein PHAVU_006G128000g [Phas... 115 2e-26 ref|XP_016481314.1| PREDICTED: WPP domain-associated protein-lik... 114 3e-26 ref|XP_016481860.1| PREDICTED: WPP domain-associated protein-lik... 114 3e-26 >ref|XP_013463012.1| WPP domain associated protein [Medicago truncatula] gb|KEH37057.1| WPP domain associated protein [Medicago truncatula] Length = 857 Score = 124 bits (312), Expect = 1e-29 Identities = 61/70 (87%), Positives = 66/70 (94%) Frame = -2 Query: 534 YKQRFETKRSDLAKAEAEVDLLGDEVDTLVRLLEKIYIALDHYSPILQHYPGVIEILELV 355 YKQRFETK SDLAKAEAEVDLLGDEVDTL+RLLE+IY+ALDHYSPILQHYPG+IEILELV Sbjct: 786 YKQRFETKSSDLAKAEAEVDLLGDEVDTLLRLLERIYVALDHYSPILQHYPGIIEILELV 845 Query: 354 RRELRGRA*K 325 RREL G + K Sbjct: 846 RRELTGESRK 855 >ref|XP_012569941.1| PREDICTED: WPP domain-associated protein isoform X2 [Cicer arietinum] Length = 819 Score = 121 bits (303), Expect = 2e-28 Identities = 59/66 (89%), Positives = 63/66 (95%) Frame = -2 Query: 534 YKQRFETKRSDLAKAEAEVDLLGDEVDTLVRLLEKIYIALDHYSPILQHYPGVIEILELV 355 YKQRFETK SDLAKAEAEVDLLGDEVDTL+RLL KIY+ALDHYSPILQHYPG+IE+LELV Sbjct: 748 YKQRFETKCSDLAKAEAEVDLLGDEVDTLLRLLGKIYVALDHYSPILQHYPGIIEVLELV 807 Query: 354 RRELRG 337 RREL G Sbjct: 808 RRELSG 813 >ref|XP_004486461.1| PREDICTED: WPP domain-associated protein isoform X1 [Cicer arietinum] Length = 857 Score = 121 bits (303), Expect = 2e-28 Identities = 59/66 (89%), Positives = 63/66 (95%) Frame = -2 Query: 534 YKQRFETKRSDLAKAEAEVDLLGDEVDTLVRLLEKIYIALDHYSPILQHYPGVIEILELV 355 YKQRFETK SDLAKAEAEVDLLGDEVDTL+RLL KIY+ALDHYSPILQHYPG+IE+LELV Sbjct: 786 YKQRFETKCSDLAKAEAEVDLLGDEVDTLLRLLGKIYVALDHYSPILQHYPGIIEVLELV 845 Query: 354 RRELRG 337 RREL G Sbjct: 846 RRELSG 851 >ref|XP_017436841.1| PREDICTED: WPP domain-associated protein [Vigna angularis] dbj|BAT87684.1| hypothetical protein VIGAN_05107800 [Vigna angularis var. angularis] Length = 852 Score = 120 bits (301), Expect = 3e-28 Identities = 59/66 (89%), Positives = 62/66 (93%) Frame = -2 Query: 534 YKQRFETKRSDLAKAEAEVDLLGDEVDTLVRLLEKIYIALDHYSPILQHYPGVIEILELV 355 YKQR ET+ SDLAKAE EVDLLGDEVDTL+RLLEKIYIALDHYSPILQHYPG+IEILELV Sbjct: 781 YKQRLETRSSDLAKAETEVDLLGDEVDTLLRLLEKIYIALDHYSPILQHYPGIIEILELV 840 Query: 354 RRELRG 337 RREL G Sbjct: 841 RRELSG 846 >ref|XP_014518810.1| WPP domain-associated protein [Vigna radiata var. radiata] Length = 852 Score = 120 bits (301), Expect = 3e-28 Identities = 59/66 (89%), Positives = 62/66 (93%) Frame = -2 Query: 534 YKQRFETKRSDLAKAEAEVDLLGDEVDTLVRLLEKIYIALDHYSPILQHYPGVIEILELV 355 YKQR ET+ SDLAKAE EVDLLGDEVDTL+RLLEKIYIALDHYSPILQHYPG+IEILELV Sbjct: 782 YKQRLETRSSDLAKAETEVDLLGDEVDTLLRLLEKIYIALDHYSPILQHYPGIIEILELV 841 Query: 354 RRELRG 337 RREL G Sbjct: 842 RRELSG 847 >ref|XP_019420011.1| PREDICTED: WPP domain-associated protein-like isoform X1 [Lupinus angustifolius] ref|XP_019420012.1| PREDICTED: WPP domain-associated protein-like isoform X1 [Lupinus angustifolius] ref|XP_019420013.1| PREDICTED: WPP domain-associated protein-like isoform X1 [Lupinus angustifolius] Length = 853 Score = 120 bits (300), Expect = 4e-28 Identities = 60/70 (85%), Positives = 63/70 (90%) Frame = -2 Query: 534 YKQRFETKRSDLAKAEAEVDLLGDEVDTLVRLLEKIYIALDHYSPILQHYPGVIEILELV 355 YKQR ETK SDL KAEAEVDLLGDEVDTL+ LLEKIYIALDHYSPILQHYPGVIEILEL+ Sbjct: 782 YKQRLETKCSDLTKAEAEVDLLGDEVDTLLNLLEKIYIALDHYSPILQHYPGVIEILELI 841 Query: 354 RRELRGRA*K 325 RREL G + K Sbjct: 842 RRELNGESRK 851 >ref|XP_006586840.1| PREDICTED: WPP domain-associated protein-like [Glycine max] gb|KHN23006.1| WPP domain-associated protein [Glycine soja] gb|KRH36801.1| hypothetical protein GLYMA_09G024600 [Glycine max] gb|KRH36802.1| hypothetical protein GLYMA_09G024600 [Glycine max] Length = 854 Score = 118 bits (296), Expect = 1e-27 Identities = 58/66 (87%), Positives = 62/66 (93%) Frame = -2 Query: 534 YKQRFETKRSDLAKAEAEVDLLGDEVDTLVRLLEKIYIALDHYSPILQHYPGVIEILELV 355 YKQ+ ETK SDL+KAEAEVDLLGDEVDTL+ LLEKIYIALDHYSPILQHYPG+IEILELV Sbjct: 783 YKQKLETKSSDLSKAEAEVDLLGDEVDTLLSLLEKIYIALDHYSPILQHYPGIIEILELV 842 Query: 354 RRELRG 337 RREL G Sbjct: 843 RRELTG 848 >gb|KYP62490.1| WPP domain-associated protein [Cajanus cajan] Length = 748 Score = 118 bits (295), Expect = 2e-27 Identities = 58/66 (87%), Positives = 61/66 (92%) Frame = -2 Query: 534 YKQRFETKRSDLAKAEAEVDLLGDEVDTLVRLLEKIYIALDHYSPILQHYPGVIEILELV 355 YKQR ET+ SDLAKAE EVDLLGDEVDTL+ LLEKIYIALDHYSPILQHYPG+IEILELV Sbjct: 677 YKQRLETRSSDLAKAEVEVDLLGDEVDTLLSLLEKIYIALDHYSPILQHYPGIIEILELV 736 Query: 354 RRELRG 337 RREL G Sbjct: 737 RRELTG 742 >ref|XP_020220749.1| WPP domain-associated protein [Cajanus cajan] Length = 853 Score = 118 bits (295), Expect = 2e-27 Identities = 58/66 (87%), Positives = 61/66 (92%) Frame = -2 Query: 534 YKQRFETKRSDLAKAEAEVDLLGDEVDTLVRLLEKIYIALDHYSPILQHYPGVIEILELV 355 YKQR ET+ SDLAKAE EVDLLGDEVDTL+ LLEKIYIALDHYSPILQHYPG+IEILELV Sbjct: 782 YKQRLETRSSDLAKAEVEVDLLGDEVDTLLSLLEKIYIALDHYSPILQHYPGIIEILELV 841 Query: 354 RRELRG 337 RREL G Sbjct: 842 RRELTG 847 >gb|KHN14327.1| WPP domain-associated protein [Glycine soja] Length = 680 Score = 117 bits (292), Expect = 4e-27 Identities = 58/66 (87%), Positives = 61/66 (92%) Frame = -2 Query: 534 YKQRFETKRSDLAKAEAEVDLLGDEVDTLVRLLEKIYIALDHYSPILQHYPGVIEILELV 355 +KQR ETK SDL KAEAEVDLLGDEVDTL+ LLEKIYIALDHYSPILQHYPG+IEILELV Sbjct: 609 HKQRLETKSSDLLKAEAEVDLLGDEVDTLLSLLEKIYIALDHYSPILQHYPGIIEILELV 668 Query: 354 RRELRG 337 RREL G Sbjct: 669 RRELTG 674 >ref|XP_003547328.1| PREDICTED: WPP domain-associated protein-like [Glycine max] gb|KRH11790.1| hypothetical protein GLYMA_15G130600 [Glycine max] Length = 854 Score = 117 bits (292), Expect = 5e-27 Identities = 58/66 (87%), Positives = 61/66 (92%) Frame = -2 Query: 534 YKQRFETKRSDLAKAEAEVDLLGDEVDTLVRLLEKIYIALDHYSPILQHYPGVIEILELV 355 +KQR ETK SDL KAEAEVDLLGDEVDTL+ LLEKIYIALDHYSPILQHYPG+IEILELV Sbjct: 783 HKQRLETKSSDLLKAEAEVDLLGDEVDTLLSLLEKIYIALDHYSPILQHYPGIIEILELV 842 Query: 354 RRELRG 337 RREL G Sbjct: 843 RRELTG 848 >ref|XP_019577352.1| PREDICTED: WPP domain-associated protein-like, partial [Rhinolophus sinicus] Length = 419 Score = 114 bits (285), Expect = 1e-26 Identities = 56/68 (82%), Positives = 62/68 (91%) Frame = -2 Query: 534 YKQRFETKRSDLAKAEAEVDLLGDEVDTLVRLLEKIYIALDHYSPILQHYPGVIEILELV 355 YKQRFE K SDL KAEAEVDLLGDEV+TL+ LLEKIYIALDHYSPIL+HYPG+IEIL+LV Sbjct: 346 YKQRFEKKSSDLQKAEAEVDLLGDEVETLLDLLEKIYIALDHYSPILKHYPGIIEILKLV 405 Query: 354 RRELRGRA 331 RREL G + Sbjct: 406 RRELSGES 413 >ref|XP_008225599.1| PREDICTED: WPP domain-associated protein [Prunus mume] ref|XP_008225600.1| PREDICTED: WPP domain-associated protein [Prunus mume] ref|XP_008225601.1| PREDICTED: WPP domain-associated protein [Prunus mume] Length = 911 Score = 115 bits (288), Expect = 2e-26 Identities = 56/66 (84%), Positives = 61/66 (92%) Frame = -2 Query: 534 YKQRFETKRSDLAKAEAEVDLLGDEVDTLVRLLEKIYIALDHYSPILQHYPGVIEILELV 355 YKQRFE K SDL KAEAEVDLLGDEVDTL+ L+EKIYIALDHYSPILQHYPG+ E+L+LV Sbjct: 841 YKQRFERKCSDLEKAEAEVDLLGDEVDTLLSLVEKIYIALDHYSPILQHYPGITEVLKLV 900 Query: 354 RRELRG 337 RRELRG Sbjct: 901 RRELRG 906 >ref|XP_018462945.1| PREDICTED: WPP domain-associated protein-like [Raphanus sativus] Length = 810 Score = 115 bits (287), Expect = 2e-26 Identities = 56/68 (82%), Positives = 62/68 (91%) Frame = -2 Query: 534 YKQRFETKRSDLAKAEAEVDLLGDEVDTLVRLLEKIYIALDHYSPILQHYPGVIEILELV 355 YKQRFE K SDL KAEAEVDLLGDEV+TL+ LLEKIYIALDHYSP+L+HYPG+IEIL+LV Sbjct: 737 YKQRFEKKSSDLQKAEAEVDLLGDEVETLLDLLEKIYIALDHYSPVLKHYPGIIEILKLV 796 Query: 354 RRELRGRA 331 RREL G A Sbjct: 797 RRELSGEA 804 >ref|XP_013734276.1| WPP domain-associated protein-like [Brassica napus] Length = 815 Score = 115 bits (287), Expect = 2e-26 Identities = 56/68 (82%), Positives = 62/68 (91%) Frame = -2 Query: 534 YKQRFETKRSDLAKAEAEVDLLGDEVDTLVRLLEKIYIALDHYSPILQHYPGVIEILELV 355 YKQRFE K SDL KAEAEVDLLGDEV+TL+ LLEKIYIALDHYSP+L+HYPG+IEIL+LV Sbjct: 742 YKQRFEKKSSDLQKAEAEVDLLGDEVETLLDLLEKIYIALDHYSPVLKHYPGIIEILKLV 801 Query: 354 RRELRGRA 331 RREL G A Sbjct: 802 RRELSGEA 809 >ref|XP_013702165.1| WPP domain-associated protein-like [Brassica napus] ref|XP_022554755.1| WPP domain-associated protein-like [Brassica napus] Length = 816 Score = 115 bits (287), Expect = 2e-26 Identities = 56/68 (82%), Positives = 62/68 (91%) Frame = -2 Query: 534 YKQRFETKRSDLAKAEAEVDLLGDEVDTLVRLLEKIYIALDHYSPILQHYPGVIEILELV 355 YKQRFE K SDL KAEAEVDLLGDEV+TL+ LLEKIYIALDHYSP+L+HYPG+IEIL+LV Sbjct: 743 YKQRFEKKSSDLQKAEAEVDLLGDEVETLLDLLEKIYIALDHYSPVLKHYPGIIEILKLV 802 Query: 354 RRELRGRA 331 RREL G A Sbjct: 803 RRELSGEA 810 >ref|XP_009132999.1| PREDICTED: WPP domain-associated protein [Brassica rapa] Length = 818 Score = 115 bits (287), Expect = 2e-26 Identities = 56/68 (82%), Positives = 62/68 (91%) Frame = -2 Query: 534 YKQRFETKRSDLAKAEAEVDLLGDEVDTLVRLLEKIYIALDHYSPILQHYPGVIEILELV 355 YKQRFE K SDL KAEAEVDLLGDEV+TL+ LLEKIYIALDHYSP+L+HYPG+IEIL+LV Sbjct: 745 YKQRFEKKSSDLQKAEAEVDLLGDEVETLLDLLEKIYIALDHYSPVLKHYPGIIEILKLV 804 Query: 354 RRELRGRA 331 RREL G A Sbjct: 805 RRELSGEA 812 >ref|XP_007147479.1| hypothetical protein PHAVU_006G128000g [Phaseolus vulgaris] gb|ESW19473.1| hypothetical protein PHAVU_006G128000g [Phaseolus vulgaris] Length = 862 Score = 115 bits (287), Expect = 2e-26 Identities = 56/66 (84%), Positives = 60/66 (90%) Frame = -2 Query: 534 YKQRFETKRSDLAKAEAEVDLLGDEVDTLVRLLEKIYIALDHYSPILQHYPGVIEILELV 355 YKQ+ ET+ SDL KAE EVDLLGDEVDTL+RLLEKIYIALDHYSPILQHYPG+IEIL LV Sbjct: 791 YKQQLETRSSDLVKAETEVDLLGDEVDTLLRLLEKIYIALDHYSPILQHYPGIIEILALV 850 Query: 354 RRELRG 337 RREL G Sbjct: 851 RRELSG 856 >ref|XP_016481314.1| PREDICTED: WPP domain-associated protein-like, partial [Nicotiana tabacum] Length = 794 Score = 114 bits (286), Expect = 3e-26 Identities = 54/66 (81%), Positives = 62/66 (93%) Frame = -2 Query: 534 YKQRFETKRSDLAKAEAEVDLLGDEVDTLVRLLEKIYIALDHYSPILQHYPGVIEILELV 355 Y+QR E + SDL KAEAEVDLLGDEVDTL+RLLEKIYIALDHYSP+LQHYPG+IEIL+L+ Sbjct: 722 YRQRLEKRCSDLQKAEAEVDLLGDEVDTLLRLLEKIYIALDHYSPVLQHYPGIIEILKLI 781 Query: 354 RRELRG 337 R+ELRG Sbjct: 782 RKELRG 787 >ref|XP_016481860.1| PREDICTED: WPP domain-associated protein-like [Nicotiana tabacum] Length = 924 Score = 114 bits (286), Expect = 3e-26 Identities = 54/66 (81%), Positives = 62/66 (93%) Frame = -2 Query: 534 YKQRFETKRSDLAKAEAEVDLLGDEVDTLVRLLEKIYIALDHYSPILQHYPGVIEILELV 355 Y+QR E + SDL KAEAEVDLLGDEVDTL+RLLEKIYIALDHYSP+LQHYPG+IEIL+L+ Sbjct: 852 YRQRLEKRCSDLQKAEAEVDLLGDEVDTLLRLLEKIYIALDHYSPVLQHYPGIIEILKLI 911 Query: 354 RRELRG 337 R+ELRG Sbjct: 912 RKELRG 917