BLASTX nr result
ID: Astragalus23_contig00030669
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus23_contig00030669 (500 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|OTF92089.1| hypothetical protein HannXRQ_Chr16g0518031 [Helia... 53 2e-06 >gb|OTF92089.1| hypothetical protein HannXRQ_Chr16g0518031 [Helianthus annuus] Length = 62 Score = 53.1 bits (126), Expect = 2e-06 Identities = 24/31 (77%), Positives = 27/31 (87%) Frame = +1 Query: 136 ICRCKKKRTTYVSMKFSRFKKLGLGFDMLMK 228 I RC+ KRTTY SMKFSRFKKLGLGFD+L + Sbjct: 31 ISRCENKRTTYKSMKFSRFKKLGLGFDILFE 61