BLASTX nr result
ID: Astragalus23_contig00030289
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus23_contig00030289 (346 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_016195224.1| uncharacterized protein LOC107636213 [Arachi... 45 9e-06 >ref|XP_016195224.1| uncharacterized protein LOC107636213 [Arachis ipaensis] Length = 205 Score = 44.7 bits (104), Expect(2) = 9e-06 Identities = 21/46 (45%), Positives = 27/46 (58%) Frame = -2 Query: 141 SCSFTWVCRDGNSVAHCIASLAQ*NLLRGNWSQNPP*LLRNTLTHD 4 +C FTWV R+ NS+AH +A L LR NW + P +RN L D Sbjct: 146 NCGFTWVPREANSLAHEVAKLTGHGTLRQNWIMHRPLSIRNILRGD 191 Score = 32.3 bits (72), Expect(2) = 9e-06 Identities = 18/56 (32%), Positives = 29/56 (51%) Frame = -3 Query: 320 SGTYLQPCATNSLPLLP*WQKTLSLHDAMTLERNLNIHHAIFEFDNQTLIEL*QSH 153 +GT L ++ + P + L++ A+ L RN + I E DNQ LI+ +SH Sbjct: 69 NGTLLSGINSSIVATSPLAAEALAVRAALILSRNFQMQKVIIESDNQMLIQALKSH 124