BLASTX nr result
ID: Astragalus23_contig00030245
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus23_contig00030245 (395 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEB37817.1| calmodulin-binding cyclic nucleotide gated channe... 182 4e-56 gb|AEB37810.1| calmodulin-binding cyclic nucleotide gated channe... 181 7e-56 gb|AEB37765.1| calmodulin-binding cyclic nucleotide gated channe... 181 7e-56 gb|ADO62375.1| putative cyclic nucleotide-gated channel, partial... 181 7e-56 gb|ADO62320.1| putative cyclic nucleotide-gated channel, partial... 181 7e-56 gb|AEB37791.1| calmodulin-binding cyclic nucleotide gated channe... 181 8e-56 gb|ADO62336.1| putative cyclic nucleotide-gated channel, partial... 181 8e-56 gb|ADO62426.1| putative cyclic nucleotide-gated channel, partial... 181 8e-56 gb|ADO62356.1| putative cyclic nucleotide-gated channel, partial... 181 8e-56 gb|ADO62392.1| putative cyclic nucleotide-gated channel, partial... 181 8e-56 gb|AEB37795.1| calmodulin-binding cyclic nucleotide gated channe... 181 8e-56 gb|AEB37793.1| calmodulin-binding cyclic nucleotide gated channe... 181 9e-56 gb|AEB37770.1| calmodulin-binding cyclic nucleotide gated channe... 181 9e-56 gb|ADO62407.1| putative cyclic nucleotide-gated channel, partial... 181 9e-56 gb|ADO62374.1| putative cyclic nucleotide-gated channel, partial... 181 9e-56 gb|ADO62354.1| putative cyclic nucleotide-gated channel, partial... 181 9e-56 gb|ADO62314.1| putative cyclic nucleotide-gated channel, partial... 181 9e-56 gb|AEB37812.1| calmodulin-binding cyclic nucleotide gated channe... 181 1e-55 gb|AEB37778.1| calmodulin-binding cyclic nucleotide gated channe... 180 2e-55 gb|AEB37779.1| calmodulin-binding cyclic nucleotide gated channe... 180 2e-55 >gb|AEB37817.1| calmodulin-binding cyclic nucleotide gated channel 15, partial [Helianthus tuberosus] Length = 184 Score = 182 bits (461), Expect = 4e-56 Identities = 89/105 (84%), Positives = 95/105 (90%) Frame = -2 Query: 394 SCCIGSGDFCGEELLTWALDPRLSVTLPYSTRTVKAISEVEAFALIAEDLKFVASQFRRL 215 SC IG GDFCGEELLTWALDPR SV LP STRTVKAISEVEAFALIA+DLKFVASQFRRL Sbjct: 76 SCRIGPGDFCGEELLTWALDPRPSVILPSSTRTVKAISEVEAFALIADDLKFVASQFRRL 135 Query: 214 HSKQLRLKFRFHSHQWRTWAACFVQAAWRRYKKRKVADKLRMDSS 80 HSKQLR KFRF+SHQWRTWAACFVQAAWRRYK+RK A +L++ S Sbjct: 136 HSKQLRHKFRFYSHQWRTWAACFVQAAWRRYKRRKSARELKVRES 180 >gb|AEB37810.1| calmodulin-binding cyclic nucleotide gated channel 15, partial [Helianthus tuberosus] Length = 177 Score = 181 bits (459), Expect = 7e-56 Identities = 89/105 (84%), Positives = 94/105 (89%) Frame = -2 Query: 394 SCCIGSGDFCGEELLTWALDPRLSVTLPYSTRTVKAISEVEAFALIAEDLKFVASQFRRL 215 SC IG GDFCGEELLTWALDPR SV LP STRTVKAISEVEAFALIA+DLKFVASQFRRL Sbjct: 73 SCRIGPGDFCGEELLTWALDPRPSVILPSSTRTVKAISEVEAFALIADDLKFVASQFRRL 132 Query: 214 HSKQLRLKFRFHSHQWRTWAACFVQAAWRRYKKRKVADKLRMDSS 80 HSKQLR KFRF+SHQWRTWAACFVQAAWRRYK+RK A +L+ S Sbjct: 133 HSKQLRHKFRFYSHQWRTWAACFVQAAWRRYKRRKSARELKARES 177 >gb|AEB37765.1| calmodulin-binding cyclic nucleotide gated channel 15, partial [Helianthus petiolaris] gb|AEB37766.1| calmodulin-binding cyclic nucleotide gated channel 15, partial [Helianthus petiolaris] Length = 179 Score = 181 bits (459), Expect = 7e-56 Identities = 89/105 (84%), Positives = 94/105 (89%) Frame = -2 Query: 394 SCCIGSGDFCGEELLTWALDPRLSVTLPYSTRTVKAISEVEAFALIAEDLKFVASQFRRL 215 SC IG GDFCGEELLTWALDPR SV LP STRTVKAISEVEAFALIA+DLKFVASQFRRL Sbjct: 73 SCRIGPGDFCGEELLTWALDPRPSVILPSSTRTVKAISEVEAFALIADDLKFVASQFRRL 132 Query: 214 HSKQLRLKFRFHSHQWRTWAACFVQAAWRRYKKRKVADKLRMDSS 80 HSKQLR KFRF+SHQWRTWAACFVQAAWRRYK+RK A +L+ S Sbjct: 133 HSKQLRHKFRFYSHQWRTWAACFVQAAWRRYKRRKSARELKARES 177 >gb|ADO62375.1| putative cyclic nucleotide-gated channel, partial [Helianthus annuus] gb|ADO62430.1| putative cyclic nucleotide-gated channel, partial [Helianthus annuus] gb|ADO62431.1| putative cyclic nucleotide-gated channel, partial [Helianthus annuus] Length = 179 Score = 181 bits (459), Expect = 7e-56 Identities = 89/105 (84%), Positives = 94/105 (89%) Frame = -2 Query: 394 SCCIGSGDFCGEELLTWALDPRLSVTLPYSTRTVKAISEVEAFALIAEDLKFVASQFRRL 215 SC IG GDFCGEELLTWALDPR SV LP STRTVKAISEVEAFALIA+DLKFVASQFRRL Sbjct: 74 SCRIGPGDFCGEELLTWALDPRPSVILPSSTRTVKAISEVEAFALIADDLKFVASQFRRL 133 Query: 214 HSKQLRLKFRFHSHQWRTWAACFVQAAWRRYKKRKVADKLRMDSS 80 HSKQLR KFRF+SHQWRTWAACFVQAAWRRYK+RK A +L+ S Sbjct: 134 HSKQLRHKFRFYSHQWRTWAACFVQAAWRRYKRRKSARELKARES 178 >gb|ADO62320.1| putative cyclic nucleotide-gated channel, partial [Helianthus argophyllus] gb|ADO62321.1| putative cyclic nucleotide-gated channel, partial [Helianthus argophyllus] Length = 179 Score = 181 bits (459), Expect = 7e-56 Identities = 89/105 (84%), Positives = 94/105 (89%) Frame = -2 Query: 394 SCCIGSGDFCGEELLTWALDPRLSVTLPYSTRTVKAISEVEAFALIAEDLKFVASQFRRL 215 SC IG GDFCGEELLTWALDPR SV LP STRTVKAISEVEAFALIA+DLKFVASQFRRL Sbjct: 74 SCRIGPGDFCGEELLTWALDPRPSVILPSSTRTVKAISEVEAFALIADDLKFVASQFRRL 133 Query: 214 HSKQLRLKFRFHSHQWRTWAACFVQAAWRRYKKRKVADKLRMDSS 80 HSKQLR KFRF+SHQWRTWAACFVQAAWRRYK+RK A +L+ S Sbjct: 134 HSKQLRHKFRFYSHQWRTWAACFVQAAWRRYKRRKSARELKARES 178 >gb|AEB37791.1| calmodulin-binding cyclic nucleotide gated channel 15, partial [Helianthus exilis] Length = 180 Score = 181 bits (459), Expect = 8e-56 Identities = 89/105 (84%), Positives = 94/105 (89%) Frame = -2 Query: 394 SCCIGSGDFCGEELLTWALDPRLSVTLPYSTRTVKAISEVEAFALIAEDLKFVASQFRRL 215 SC IG GDFCGEELLTWALDPR SV LP STRTVKAISEVEAFALIA+DLKFVASQFRRL Sbjct: 74 SCRIGPGDFCGEELLTWALDPRPSVILPSSTRTVKAISEVEAFALIADDLKFVASQFRRL 133 Query: 214 HSKQLRLKFRFHSHQWRTWAACFVQAAWRRYKKRKVADKLRMDSS 80 HSKQLR KFRF+SHQWRTWAACFVQAAWRRYK+RK A +L+ S Sbjct: 134 HSKQLRHKFRFYSHQWRTWAACFVQAAWRRYKRRKSARELKARES 178 >gb|ADO62336.1| putative cyclic nucleotide-gated channel, partial [Helianthus annuus] gb|ADO62337.1| putative cyclic nucleotide-gated channel, partial [Helianthus annuus] gb|ADO62358.1| putative cyclic nucleotide-gated channel, partial [Helianthus annuus] gb|ADO62359.1| putative cyclic nucleotide-gated channel, partial [Helianthus annuus] gb|ADO62366.1| putative cyclic nucleotide-gated channel, partial [Helianthus annuus] gb|ADO62367.1| putative cyclic nucleotide-gated channel, partial [Helianthus annuus] gb|ADO62390.1| putative cyclic nucleotide-gated channel, partial [Helianthus annuus] gb|ADO62391.1| putative cyclic nucleotide-gated channel, partial [Helianthus annuus] gb|ADO62400.1| putative cyclic nucleotide-gated channel, partial [Helianthus annuus] gb|ADO62401.1| putative cyclic nucleotide-gated channel, partial [Helianthus annuus] gb|ADO62402.1| putative cyclic nucleotide-gated channel, partial [Helianthus annuus] gb|ADO62403.1| putative cyclic nucleotide-gated channel, partial [Helianthus annuus] gb|ADO62404.1| putative cyclic nucleotide-gated channel, partial [Helianthus annuus] gb|ADO62405.1| putative cyclic nucleotide-gated channel, partial [Helianthus annuus] gb|ADO62412.1| putative cyclic nucleotide-gated channel, partial [Helianthus annuus] gb|ADO62413.1| putative cyclic nucleotide-gated channel, partial [Helianthus annuus] gb|ADO62422.1| putative cyclic nucleotide-gated channel, partial [Helianthus annuus] gb|ADO62423.1| putative cyclic nucleotide-gated channel, partial [Helianthus annuus] gb|ADO62432.1| putative cyclic nucleotide-gated channel, partial [Helianthus annuus] gb|ADO62433.1| putative cyclic nucleotide-gated channel, partial [Helianthus annuus] gb|ADO62434.1| putative cyclic nucleotide-gated channel, partial [Helianthus annuus] gb|ADO62435.1| putative cyclic nucleotide-gated channel, partial [Helianthus annuus] gb|ADO62436.1| putative cyclic nucleotide-gated channel, partial [Helianthus annuus] gb|ADO62437.1| putative cyclic nucleotide-gated channel, partial [Helianthus annuus] gb|ADO62440.1| putative cyclic nucleotide-gated channel, partial [Helianthus annuus] gb|ADO62441.1| putative cyclic nucleotide-gated channel, partial [Helianthus annuus] gb|AEB37767.1| calmodulin-binding cyclic nucleotide gated channel 15, partial [Helianthus petiolaris] gb|AEB37768.1| calmodulin-binding cyclic nucleotide gated channel 15, partial [Helianthus petiolaris] gb|AEB37775.1| calmodulin-binding cyclic nucleotide gated channel 15, partial [Helianthus petiolaris] gb|AEB37776.1| calmodulin-binding cyclic nucleotide gated channel 15, partial [Helianthus petiolaris] gb|AEB37777.1| calmodulin-binding cyclic nucleotide gated channel 15, partial [Helianthus paradoxus] gb|AEB37792.1| calmodulin-binding cyclic nucleotide gated channel 15, partial [Helianthus exilis] gb|AEB37799.1| calmodulin-binding cyclic nucleotide gated channel 15, partial [Helianthus exilis] gb|AEB37800.1| calmodulin-binding cyclic nucleotide gated channel 15, partial [Helianthus exilis] gb|AEB37816.1| calmodulin-binding cyclic nucleotide gated channel 15, partial [Helianthus tuberosus] Length = 180 Score = 181 bits (459), Expect = 8e-56 Identities = 89/105 (84%), Positives = 94/105 (89%) Frame = -2 Query: 394 SCCIGSGDFCGEELLTWALDPRLSVTLPYSTRTVKAISEVEAFALIAEDLKFVASQFRRL 215 SC IG GDFCGEELLTWALDPR SV LP STRTVKAISEVEAFALIA+DLKFVASQFRRL Sbjct: 74 SCRIGPGDFCGEELLTWALDPRPSVILPSSTRTVKAISEVEAFALIADDLKFVASQFRRL 133 Query: 214 HSKQLRLKFRFHSHQWRTWAACFVQAAWRRYKKRKVADKLRMDSS 80 HSKQLR KFRF+SHQWRTWAACFVQAAWRRYK+RK A +L+ S Sbjct: 134 HSKQLRHKFRFYSHQWRTWAACFVQAAWRRYKRRKSARELKARES 178 >gb|ADO62426.1| putative cyclic nucleotide-gated channel, partial [Helianthus annuus] gb|ADO62427.1| putative cyclic nucleotide-gated channel, partial [Helianthus annuus] gb|AEB37796.1| calmodulin-binding cyclic nucleotide gated channel 15, partial [Helianthus exilis] gb|AEB37818.1| calmodulin-binding cyclic nucleotide gated channel 15, partial [Helianthus tuberosus] Length = 181 Score = 181 bits (459), Expect = 8e-56 Identities = 89/105 (84%), Positives = 94/105 (89%) Frame = -2 Query: 394 SCCIGSGDFCGEELLTWALDPRLSVTLPYSTRTVKAISEVEAFALIAEDLKFVASQFRRL 215 SC IG GDFCGEELLTWALDPR SV LP STRTVKAISEVEAFALIA+DLKFVASQFRRL Sbjct: 75 SCRIGPGDFCGEELLTWALDPRPSVILPSSTRTVKAISEVEAFALIADDLKFVASQFRRL 134 Query: 214 HSKQLRLKFRFHSHQWRTWAACFVQAAWRRYKKRKVADKLRMDSS 80 HSKQLR KFRF+SHQWRTWAACFVQAAWRRYK+RK A +L+ S Sbjct: 135 HSKQLRHKFRFYSHQWRTWAACFVQAAWRRYKRRKSARELKARES 179 >gb|ADO62356.1| putative cyclic nucleotide-gated channel, partial [Helianthus annuus] gb|ADO62357.1| putative cyclic nucleotide-gated channel, partial [Helianthus annuus] gb|ADO62362.1| putative cyclic nucleotide-gated channel, partial [Helianthus annuus] gb|ADO62363.1| putative cyclic nucleotide-gated channel, partial [Helianthus annuus] Length = 181 Score = 181 bits (459), Expect = 8e-56 Identities = 89/105 (84%), Positives = 94/105 (89%) Frame = -2 Query: 394 SCCIGSGDFCGEELLTWALDPRLSVTLPYSTRTVKAISEVEAFALIAEDLKFVASQFRRL 215 SC IG GDFCGEELLTWALDPR SV LP STRTVKAISEVEAFALIA+DLKFVASQFRRL Sbjct: 76 SCRIGPGDFCGEELLTWALDPRPSVILPSSTRTVKAISEVEAFALIADDLKFVASQFRRL 135 Query: 214 HSKQLRLKFRFHSHQWRTWAACFVQAAWRRYKKRKVADKLRMDSS 80 HSKQLR KFRF+SHQWRTWAACFVQAAWRRYK+RK A +L+ S Sbjct: 136 HSKQLRHKFRFYSHQWRTWAACFVQAAWRRYKRRKSARELKARES 180 >gb|ADO62392.1| putative cyclic nucleotide-gated channel, partial [Helianthus annuus] gb|ADO62393.1| putative cyclic nucleotide-gated channel, partial [Helianthus annuus] gb|AEB37802.1| calmodulin-binding cyclic nucleotide gated channel 15, partial [Helianthus tuberosus] Length = 182 Score = 181 bits (459), Expect = 8e-56 Identities = 89/105 (84%), Positives = 94/105 (89%) Frame = -2 Query: 394 SCCIGSGDFCGEELLTWALDPRLSVTLPYSTRTVKAISEVEAFALIAEDLKFVASQFRRL 215 SC IG GDFCGEELLTWALDPR SV LP STRTVKAISEVEAFALIA+DLKFVASQFRRL Sbjct: 76 SCRIGPGDFCGEELLTWALDPRPSVILPSSTRTVKAISEVEAFALIADDLKFVASQFRRL 135 Query: 214 HSKQLRLKFRFHSHQWRTWAACFVQAAWRRYKKRKVADKLRMDSS 80 HSKQLR KFRF+SHQWRTWAACFVQAAWRRYK+RK A +L+ S Sbjct: 136 HSKQLRHKFRFYSHQWRTWAACFVQAAWRRYKRRKSARELKARES 180 >gb|AEB37795.1| calmodulin-binding cyclic nucleotide gated channel 15, partial [Helianthus exilis] Length = 183 Score = 181 bits (459), Expect = 8e-56 Identities = 89/105 (84%), Positives = 94/105 (89%) Frame = -2 Query: 394 SCCIGSGDFCGEELLTWALDPRLSVTLPYSTRTVKAISEVEAFALIAEDLKFVASQFRRL 215 SC IG GDFCGEELLTWALDPR SV LP STRTVKAISEVEAFALIA+DLKFVASQFRRL Sbjct: 75 SCRIGPGDFCGEELLTWALDPRPSVILPSSTRTVKAISEVEAFALIADDLKFVASQFRRL 134 Query: 214 HSKQLRLKFRFHSHQWRTWAACFVQAAWRRYKKRKVADKLRMDSS 80 HSKQLR KFRF+SHQWRTWAACFVQAAWRRYK+RK A +L+ S Sbjct: 135 HSKQLRHKFRFYSHQWRTWAACFVQAAWRRYKRRKSARELKARES 179 >gb|AEB37793.1| calmodulin-binding cyclic nucleotide gated channel 15, partial [Helianthus exilis] gb|AEB37794.1| calmodulin-binding cyclic nucleotide gated channel 15, partial [Helianthus exilis] Length = 184 Score = 181 bits (459), Expect = 9e-56 Identities = 89/105 (84%), Positives = 94/105 (89%) Frame = -2 Query: 394 SCCIGSGDFCGEELLTWALDPRLSVTLPYSTRTVKAISEVEAFALIAEDLKFVASQFRRL 215 SC IG GDFCGEELLTWALDPR SV LP STRTVKAISEVEAFALIA+DLKFVASQFRRL Sbjct: 76 SCRIGPGDFCGEELLTWALDPRPSVILPSSTRTVKAISEVEAFALIADDLKFVASQFRRL 135 Query: 214 HSKQLRLKFRFHSHQWRTWAACFVQAAWRRYKKRKVADKLRMDSS 80 HSKQLR KFRF+SHQWRTWAACFVQAAWRRYK+RK A +L+ S Sbjct: 136 HSKQLRHKFRFYSHQWRTWAACFVQAAWRRYKRRKSARELKARES 180 >gb|AEB37770.1| calmodulin-binding cyclic nucleotide gated channel 15, partial [Helianthus petiolaris] Length = 184 Score = 181 bits (459), Expect = 9e-56 Identities = 89/105 (84%), Positives = 94/105 (89%) Frame = -2 Query: 394 SCCIGSGDFCGEELLTWALDPRLSVTLPYSTRTVKAISEVEAFALIAEDLKFVASQFRRL 215 SC IG GDFCGEELLTWALDPR SV LP STRTVKAISEVEAFALIA+DLKFVASQFRRL Sbjct: 76 SCRIGPGDFCGEELLTWALDPRPSVILPSSTRTVKAISEVEAFALIADDLKFVASQFRRL 135 Query: 214 HSKQLRLKFRFHSHQWRTWAACFVQAAWRRYKKRKVADKLRMDSS 80 HSKQLR KFRF+SHQWRTWAACFVQAAWRRYK+RK A +L+ S Sbjct: 136 HSKQLRHKFRFYSHQWRTWAACFVQAAWRRYKRRKSARELKARES 180 >gb|ADO62407.1| putative cyclic nucleotide-gated channel, partial [Helianthus annuus] Length = 184 Score = 181 bits (459), Expect = 9e-56 Identities = 89/105 (84%), Positives = 94/105 (89%) Frame = -2 Query: 394 SCCIGSGDFCGEELLTWALDPRLSVTLPYSTRTVKAISEVEAFALIAEDLKFVASQFRRL 215 SC IG GDFCGEELLTWALDPR SV LP STRTVKAISEVEAFALIA+DLKFVASQFRRL Sbjct: 76 SCRIGPGDFCGEELLTWALDPRPSVILPSSTRTVKAISEVEAFALIADDLKFVASQFRRL 135 Query: 214 HSKQLRLKFRFHSHQWRTWAACFVQAAWRRYKKRKVADKLRMDSS 80 HSKQLR KFRF+SHQWRTWAACFVQAAWRRYK+RK A +L+ S Sbjct: 136 HSKQLRHKFRFYSHQWRTWAACFVQAAWRRYKRRKSARELKARES 180 >gb|ADO62374.1| putative cyclic nucleotide-gated channel, partial [Helianthus annuus] Length = 184 Score = 181 bits (459), Expect = 9e-56 Identities = 89/105 (84%), Positives = 94/105 (89%) Frame = -2 Query: 394 SCCIGSGDFCGEELLTWALDPRLSVTLPYSTRTVKAISEVEAFALIAEDLKFVASQFRRL 215 SC IG GDFCGEELLTWALDPR SV LP STRTVKAISEVEAFALIA+DLKFVASQFRRL Sbjct: 76 SCRIGPGDFCGEELLTWALDPRPSVILPSSTRTVKAISEVEAFALIADDLKFVASQFRRL 135 Query: 214 HSKQLRLKFRFHSHQWRTWAACFVQAAWRRYKKRKVADKLRMDSS 80 HSKQLR KFRF+SHQWRTWAACFVQAAWRRYK+RK A +L+ S Sbjct: 136 HSKQLRHKFRFYSHQWRTWAACFVQAAWRRYKRRKSARELKARES 180 >gb|ADO62354.1| putative cyclic nucleotide-gated channel, partial [Helianthus annuus] gb|ADO62355.1| putative cyclic nucleotide-gated channel, partial [Helianthus annuus] Length = 184 Score = 181 bits (459), Expect = 9e-56 Identities = 89/105 (84%), Positives = 94/105 (89%) Frame = -2 Query: 394 SCCIGSGDFCGEELLTWALDPRLSVTLPYSTRTVKAISEVEAFALIAEDLKFVASQFRRL 215 SC IG GDFCGEELLTWALDPR SV LP STRTVKAISEVEAFALIA+DLKFVASQFRRL Sbjct: 76 SCRIGPGDFCGEELLTWALDPRPSVILPSSTRTVKAISEVEAFALIADDLKFVASQFRRL 135 Query: 214 HSKQLRLKFRFHSHQWRTWAACFVQAAWRRYKKRKVADKLRMDSS 80 HSKQLR KFRF+SHQWRTWAACFVQAAWRRYK+RK A +L+ S Sbjct: 136 HSKQLRHKFRFYSHQWRTWAACFVQAAWRRYKRRKSARELKARES 180 >gb|ADO62314.1| putative cyclic nucleotide-gated channel, partial [Helianthus argophyllus] gb|ADO62315.1| putative cyclic nucleotide-gated channel, partial [Helianthus argophyllus] gb|ADO62316.1| putative cyclic nucleotide-gated channel, partial [Helianthus argophyllus] gb|ADO62317.1| putative cyclic nucleotide-gated channel, partial [Helianthus argophyllus] gb|ADO62318.1| putative cyclic nucleotide-gated channel, partial [Helianthus argophyllus] gb|ADO62319.1| putative cyclic nucleotide-gated channel, partial [Helianthus argophyllus] gb|ADO62322.1| putative cyclic nucleotide-gated channel, partial [Helianthus argophyllus] gb|ADO62323.1| putative cyclic nucleotide-gated channel, partial [Helianthus argophyllus] gb|ADO62324.1| putative cyclic nucleotide-gated channel, partial [Helianthus argophyllus] gb|ADO62325.1| putative cyclic nucleotide-gated channel, partial [Helianthus argophyllus] gb|ADO62326.1| putative cyclic nucleotide-gated channel, partial [Helianthus annuus] gb|ADO62327.1| putative cyclic nucleotide-gated channel, partial [Helianthus annuus] gb|ADO62328.1| putative cyclic nucleotide-gated channel, partial [Helianthus annuus] gb|ADO62329.1| putative cyclic nucleotide-gated channel, partial [Helianthus annuus] gb|ADO62330.1| putative cyclic nucleotide-gated channel, partial [Helianthus annuus] gb|ADO62331.1| putative cyclic nucleotide-gated channel, partial [Helianthus annuus] gb|ADO62332.1| putative cyclic nucleotide-gated channel, partial [Helianthus annuus] gb|ADO62333.1| putative cyclic nucleotide-gated channel, partial [Helianthus annuus] gb|ADO62334.1| putative cyclic nucleotide-gated channel, partial [Helianthus annuus] gb|ADO62335.1| putative cyclic nucleotide-gated channel, partial [Helianthus annuus] gb|ADO62338.1| putative cyclic nucleotide-gated channel, partial [Helianthus annuus] gb|ADO62339.1| putative cyclic nucleotide-gated channel, partial [Helianthus annuus] gb|ADO62340.1| putative cyclic nucleotide-gated channel, partial [Helianthus annuus] gb|ADO62341.1| putative cyclic nucleotide-gated channel, partial [Helianthus annuus] gb|ADO62342.1| putative cyclic nucleotide-gated channel, partial [Helianthus annuus] gb|ADO62343.1| putative cyclic nucleotide-gated channel, partial [Helianthus annuus] gb|ADO62344.1| putative cyclic nucleotide-gated channel, partial [Helianthus annuus] gb|ADO62345.1| putative cyclic nucleotide-gated channel, partial [Helianthus annuus] gb|ADO62346.1| putative cyclic nucleotide-gated channel, partial [Helianthus annuus] gb|ADO62347.1| putative cyclic nucleotide-gated channel, partial [Helianthus annuus] gb|ADO62348.1| putative cyclic nucleotide-gated channel, partial [Helianthus annuus] gb|ADO62349.1| putative cyclic nucleotide-gated channel, partial [Helianthus annuus] gb|ADO62350.1| putative cyclic nucleotide-gated channel, partial [Helianthus annuus] gb|ADO62351.1| putative cyclic nucleotide-gated channel, partial [Helianthus annuus] gb|ADO62352.1| putative cyclic nucleotide-gated channel, partial [Helianthus annuus] gb|ADO62353.1| putative cyclic nucleotide-gated channel, partial [Helianthus annuus] gb|ADO62360.1| putative cyclic nucleotide-gated channel, partial [Helianthus annuus] gb|ADO62361.1| putative cyclic nucleotide-gated channel, partial [Helianthus annuus] gb|ADO62364.1| putative cyclic nucleotide-gated channel, partial [Helianthus annuus] gb|ADO62365.1| putative cyclic nucleotide-gated channel, partial [Helianthus annuus] gb|ADO62368.1| putative cyclic nucleotide-gated channel, partial [Helianthus annuus] gb|ADO62369.1| putative cyclic nucleotide-gated channel, partial [Helianthus annuus] gb|ADO62370.1| putative cyclic nucleotide-gated channel, partial [Helianthus annuus] gb|ADO62371.1| putative cyclic nucleotide-gated channel, partial [Helianthus annuus] gb|ADO62372.1| putative cyclic nucleotide-gated channel, partial [Helianthus annuus] gb|ADO62373.1| putative cyclic nucleotide-gated channel, partial [Helianthus annuus] gb|ADO62376.1| putative cyclic nucleotide-gated channel, partial [Helianthus annuus] gb|ADO62377.1| putative cyclic nucleotide-gated channel, partial [Helianthus annuus] gb|ADO62378.1| putative cyclic nucleotide-gated channel, partial [Helianthus annuus] gb|ADO62379.1| putative cyclic nucleotide-gated channel, partial [Helianthus annuus] gb|ADO62380.1| putative cyclic nucleotide-gated channel, partial [Helianthus annuus] gb|ADO62381.1| putative cyclic nucleotide-gated channel, partial [Helianthus annuus] gb|ADO62382.1| putative cyclic nucleotide-gated channel, partial [Helianthus annuus] gb|ADO62383.1| putative cyclic nucleotide-gated channel, partial [Helianthus annuus] gb|ADO62386.1| putative cyclic nucleotide-gated channel, partial [Helianthus annuus] gb|ADO62387.1| putative cyclic nucleotide-gated channel, partial [Helianthus annuus] gb|ADO62388.1| putative cyclic nucleotide-gated channel, partial [Helianthus annuus] gb|ADO62389.1| putative cyclic nucleotide-gated channel, partial [Helianthus annuus] gb|ADO62394.1| putative cyclic nucleotide-gated channel, partial [Helianthus annuus] gb|ADO62395.1| putative cyclic nucleotide-gated channel, partial [Helianthus annuus] gb|ADO62396.1| putative cyclic nucleotide-gated channel, partial [Helianthus annuus] gb|ADO62397.1| putative cyclic nucleotide-gated channel, partial [Helianthus annuus] gb|ADO62398.1| putative cyclic nucleotide-gated channel, partial [Helianthus annuus] gb|ADO62399.1| putative cyclic nucleotide-gated channel, partial [Helianthus annuus] gb|ADO62409.1| putative cyclic nucleotide-gated channel, partial [Helianthus annuus] gb|ADO62410.1| putative cyclic nucleotide-gated channel, partial [Helianthus annuus] gb|ADO62411.1| putative cyclic nucleotide-gated channel, partial [Helianthus annuus] gb|ADO62414.1| putative cyclic nucleotide-gated channel, partial [Helianthus annuus] gb|ADO62415.1| putative cyclic nucleotide-gated channel, partial [Helianthus annuus] gb|ADO62416.1| putative cyclic nucleotide-gated channel, partial [Helianthus annuus] gb|ADO62417.1| putative cyclic nucleotide-gated channel, partial [Helianthus annuus] gb|ADO62418.1| putative cyclic nucleotide-gated channel, partial [Helianthus annuus] gb|ADO62419.1| putative cyclic nucleotide-gated channel, partial [Helianthus annuus] gb|ADO62420.1| putative cyclic nucleotide-gated channel, partial [Helianthus annuus] gb|ADO62421.1| putative cyclic nucleotide-gated channel, partial [Helianthus annuus] gb|ADO62424.1| putative cyclic nucleotide-gated channel, partial [Helianthus annuus] gb|ADO62425.1| putative cyclic nucleotide-gated channel, partial [Helianthus annuus] gb|ADO62428.1| putative cyclic nucleotide-gated channel, partial [Helianthus annuus] gb|ADO62429.1| putative cyclic nucleotide-gated channel, partial [Helianthus annuus] gb|ADO62438.1| putative cyclic nucleotide-gated channel, partial [Helianthus annuus] gb|ADO62439.1| putative cyclic nucleotide-gated channel, partial [Helianthus annuus] gb|ADO62442.1| putative cyclic nucleotide-gated channel, partial [Helianthus annuus] gb|ADO62443.1| putative cyclic nucleotide-gated channel, partial [Helianthus annuus] gb|ADO62444.1| putative cyclic nucleotide-gated channel, partial [Helianthus annuus] gb|ADO62445.1| putative cyclic nucleotide-gated channel, partial [Helianthus annuus] gb|AEB37769.1| calmodulin-binding cyclic nucleotide gated channel 15, partial [Helianthus petiolaris] gb|AEB37771.1| calmodulin-binding cyclic nucleotide gated channel 15, partial [Helianthus petiolaris] gb|AEB37772.1| calmodulin-binding cyclic nucleotide gated channel 15, partial [Helianthus petiolaris] gb|AEB37773.1| calmodulin-binding cyclic nucleotide gated channel 15, partial [Helianthus petiolaris] gb|AEB37774.1| calmodulin-binding cyclic nucleotide gated channel 15, partial [Helianthus petiolaris] gb|AEB37783.1| calmodulin-binding cyclic nucleotide gated channel 15, partial [Helianthus paradoxus] gb|AEB37784.1| calmodulin-binding cyclic nucleotide gated channel 15, partial [Helianthus paradoxus] gb|AEB37785.1| calmodulin-binding cyclic nucleotide gated channel 15, partial [Helianthus paradoxus] gb|AEB37786.1| calmodulin-binding cyclic nucleotide gated channel 15, partial [Helianthus paradoxus] gb|AEB37789.1| calmodulin-binding cyclic nucleotide gated channel 15, partial [Helianthus exilis] gb|AEB37790.1| calmodulin-binding cyclic nucleotide gated channel 15, partial [Helianthus exilis] gb|AEB37797.1| calmodulin-binding cyclic nucleotide gated channel 15, partial [Helianthus exilis] gb|AEB37798.1| calmodulin-binding cyclic nucleotide gated channel 15, partial [Helianthus exilis] gb|AEB37801.1| calmodulin-binding cyclic nucleotide gated channel 15, partial [Helianthus tuberosus] gb|AEB37803.1| calmodulin-binding cyclic nucleotide gated channel 15, partial [Helianthus tuberosus] gb|AEB37805.1| calmodulin-binding cyclic nucleotide gated channel 15, partial [Helianthus tuberosus] gb|AEB37806.1| calmodulin-binding cyclic nucleotide gated channel 15, partial [Helianthus tuberosus] gb|AEB37807.1| calmodulin-binding cyclic nucleotide gated channel 15, partial [Helianthus tuberosus] gb|AEB37808.1| calmodulin-binding cyclic nucleotide gated channel 15, partial [Helianthus tuberosus] gb|AEB37809.1| calmodulin-binding cyclic nucleotide gated channel 15, partial [Helianthus tuberosus] gb|AEB37811.1| calmodulin-binding cyclic nucleotide gated channel 15, partial [Helianthus tuberosus] gb|AEB37813.1| calmodulin-binding cyclic nucleotide gated channel 15, partial [Helianthus tuberosus] gb|AEB37814.1| calmodulin-binding cyclic nucleotide gated channel 15, partial [Helianthus tuberosus] gb|AEB37815.1| calmodulin-binding cyclic nucleotide gated channel 15, partial [Helianthus tuberosus] gb|AEB37819.1| calmodulin-binding cyclic nucleotide gated channel 15, partial [Helianthus tuberosus] gb|AEB37820.1| calmodulin-binding cyclic nucleotide gated channel 15, partial [Helianthus tuberosus] gb|AEB37823.1| calmodulin-binding cyclic nucleotide gated channel 15, partial [Helianthus tuberosus] gb|AEB37824.1| calmodulin-binding cyclic nucleotide gated channel 15, partial [Helianthus tuberosus] Length = 184 Score = 181 bits (459), Expect = 9e-56 Identities = 89/105 (84%), Positives = 94/105 (89%) Frame = -2 Query: 394 SCCIGSGDFCGEELLTWALDPRLSVTLPYSTRTVKAISEVEAFALIAEDLKFVASQFRRL 215 SC IG GDFCGEELLTWALDPR SV LP STRTVKAISEVEAFALIA+DLKFVASQFRRL Sbjct: 76 SCRIGPGDFCGEELLTWALDPRPSVILPSSTRTVKAISEVEAFALIADDLKFVASQFRRL 135 Query: 214 HSKQLRLKFRFHSHQWRTWAACFVQAAWRRYKKRKVADKLRMDSS 80 HSKQLR KFRF+SHQWRTWAACFVQAAWRRYK+RK A +L+ S Sbjct: 136 HSKQLRHKFRFYSHQWRTWAACFVQAAWRRYKRRKSARELKARES 180 >gb|AEB37812.1| calmodulin-binding cyclic nucleotide gated channel 15, partial [Helianthus tuberosus] Length = 177 Score = 181 bits (458), Expect = 1e-55 Identities = 88/101 (87%), Positives = 93/101 (92%) Frame = -2 Query: 394 SCCIGSGDFCGEELLTWALDPRLSVTLPYSTRTVKAISEVEAFALIAEDLKFVASQFRRL 215 SC IG GDFCGEELLTWALDPR SV LP STRTVKAISEVEAFALIA+DLKFVASQFRRL Sbjct: 74 SCRIGPGDFCGEELLTWALDPRPSVILPSSTRTVKAISEVEAFALIADDLKFVASQFRRL 133 Query: 214 HSKQLRLKFRFHSHQWRTWAACFVQAAWRRYKKRKVADKLR 92 HSKQLR KFRF+SHQWRTWAACFVQAAWRRYK+RK A +L+ Sbjct: 134 HSKQLRHKFRFYSHQWRTWAACFVQAAWRRYKRRKSARELK 174 >gb|AEB37778.1| calmodulin-binding cyclic nucleotide gated channel 15, partial [Helianthus paradoxus] Length = 180 Score = 180 bits (457), Expect = 2e-55 Identities = 89/105 (84%), Positives = 94/105 (89%) Frame = -2 Query: 394 SCCIGSGDFCGEELLTWALDPRLSVTLPYSTRTVKAISEVEAFALIAEDLKFVASQFRRL 215 SC IG GDFCGEELLTWALDPR SV LP STRTVKAISEVEAFALIA+DLKFVASQFRRL Sbjct: 74 SCRIGPGDFCGEELLTWALDPRPSVILPSSTRTVKAISEVEAFALIADDLKFVASQFRRL 133 Query: 214 HSKQLRLKFRFHSHQWRTWAACFVQAAWRRYKKRKVADKLRMDSS 80 HSKQLR KFRF+SHQWRTWAACFVQAAWRRYK+RK A +L+ S Sbjct: 134 HSKQLRHKFRFYSHQWRTWAACFVQAAWRRYKRRKSAWELKARES 178 >gb|AEB37779.1| calmodulin-binding cyclic nucleotide gated channel 15, partial [Helianthus paradoxus] gb|AEB37780.1| calmodulin-binding cyclic nucleotide gated channel 15, partial [Helianthus paradoxus] gb|AEB37781.1| calmodulin-binding cyclic nucleotide gated channel 15, partial [Helianthus paradoxus] gb|AEB37782.1| calmodulin-binding cyclic nucleotide gated channel 15, partial [Helianthus paradoxus] gb|AEB37787.1| calmodulin-binding cyclic nucleotide gated channel 15, partial [Helianthus paradoxus] gb|AEB37788.1| calmodulin-binding cyclic nucleotide gated channel 15, partial [Helianthus paradoxus] Length = 184 Score = 180 bits (457), Expect = 2e-55 Identities = 89/105 (84%), Positives = 94/105 (89%) Frame = -2 Query: 394 SCCIGSGDFCGEELLTWALDPRLSVTLPYSTRTVKAISEVEAFALIAEDLKFVASQFRRL 215 SC IG GDFCGEELLTWALDPR SV LP STRTVKAISEVEAFALIA+DLKFVASQFRRL Sbjct: 76 SCRIGPGDFCGEELLTWALDPRPSVILPSSTRTVKAISEVEAFALIADDLKFVASQFRRL 135 Query: 214 HSKQLRLKFRFHSHQWRTWAACFVQAAWRRYKKRKVADKLRMDSS 80 HSKQLR KFRF+SHQWRTWAACFVQAAWRRYK+RK A +L+ S Sbjct: 136 HSKQLRHKFRFYSHQWRTWAACFVQAAWRRYKRRKSAWELKARES 180