BLASTX nr result
ID: Astragalus23_contig00030191
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus23_contig00030191 (385 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KHN21230.1| Retrovirus-related Pol polyprotein from transposo... 75 5e-13 >gb|KHN21230.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94, partial [Glycine soja] Length = 1429 Score = 74.7 bits (182), Expect = 5e-13 Identities = 34/38 (89%), Positives = 35/38 (92%) Frame = +2 Query: 272 MQTRSKTGHLKPPLYPTINLTVTEPTTVQQALSSTHWT 385 M TRSKTGHLKPPL+PTINLT TEPTTVQQALSS HWT Sbjct: 892 MLTRSKTGHLKPPLFPTINLTTTEPTTVQQALSSIHWT 929