BLASTX nr result
ID: Astragalus23_contig00030032
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus23_contig00030032 (346 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004485478.1| PREDICTED: ATP-dependent DNA helicase Q-like... 61 2e-08 ref|XP_003592989.2| ATP-dependent DNA helicase RecQ family prote... 58 2e-07 >ref|XP_004485478.1| PREDICTED: ATP-dependent DNA helicase Q-like 4A [Cicer arietinum] ref|XP_004485479.1| PREDICTED: ATP-dependent DNA helicase Q-like 4A [Cicer arietinum] Length = 1157 Score = 61.2 bits (147), Expect = 2e-08 Identities = 33/59 (55%), Positives = 37/59 (62%), Gaps = 1/59 (1%) Frame = +1 Query: 172 FHEDMT-THFQGSYEKDKLRRPDXXXXXXXXINHSSRVSDSSANNHTKYTSQIIAALFC 345 FHED + T F GSYE DK+R PD INHSSRV D+S NNHTKY SQ + C Sbjct: 101 FHEDRSATSFPGSYENDKIRHPDVTATPIV-INHSSRVLDTSVNNHTKYASQTNKSAKC 158 >ref|XP_003592989.2| ATP-dependent DNA helicase RecQ family protein [Medicago truncatula] gb|AES63240.2| ATP-dependent DNA helicase RecQ family protein [Medicago truncatula] Length = 1159 Score = 58.2 bits (139), Expect = 2e-07 Identities = 32/59 (54%), Positives = 36/59 (61%), Gaps = 1/59 (1%) Frame = +1 Query: 172 FHEDMTT-HFQGSYEKDKLRRPDXXXXXXXXINHSSRVSDSSANNHTKYTSQIIAALFC 345 FHE+ TT FQGSYE +KL PD INH+SRV DS NNHTKYT Q + C Sbjct: 103 FHENRTTTSFQGSYENNKLNHPDVAATPTV-INHTSRVVDSLVNNHTKYTGQTNESTKC 160