BLASTX nr result
ID: Astragalus23_contig00029831
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus23_contig00029831 (306 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GAU28450.1| hypothetical protein TSUD_55010 [Trifolium subte... 118 9e-30 gb|ACU21082.1| unknown [Glycine max] 111 4e-29 ref|XP_016169836.1| interactor of constitutive active ROPs 4 [Ar... 115 1e-28 ref|XP_015933594.1| interactor of constitutive active ROPs 4 [Ar... 115 1e-28 gb|KYP38170.1| Interactor of constitutive active ROPs 4 [Cajanus... 110 1e-28 ref|XP_013464384.1| interactor of constitutive active ROPs prote... 114 4e-28 gb|PNY02400.1| interactor of constitutive active ROPS 1-like pro... 113 1e-27 ref|XP_003626756.1| elongation factor 1-alpha [Medicago truncatu... 114 1e-27 gb|PNX92292.1| interactor of constitutive active ROPS 1-like pro... 112 1e-27 gb|KHN29852.1| Interactor of constitutive active ROPs 1 [Glycine... 111 4e-27 ref|XP_003546766.1| PREDICTED: interactor of constitutive active... 111 4e-27 ref|XP_020204184.1| interactor of constitutive active ROPs 4-lik... 110 1e-26 ref|XP_019443794.1| PREDICTED: interactor of constitutive active... 110 1e-26 gb|KHN47479.1| Interactor of constitutive active ROPs 4 [Glycine... 110 1e-26 ref|XP_003543151.1| PREDICTED: interactor of constitutive active... 110 1e-26 ref|XP_007149321.1| hypothetical protein PHAVU_005G060700g [Phas... 110 1e-26 ref|XP_017425622.1| PREDICTED: interactor of constitutive active... 109 2e-26 ref|XP_014502149.1| interactor of constitutive active ROPs 4 [Vi... 107 2e-25 ref|XP_004488646.1| PREDICTED: interactor of constitutive active... 106 2e-25 ref|XP_011006705.1| PREDICTED: interactor of constitutive active... 103 5e-24 >dbj|GAU28450.1| hypothetical protein TSUD_55010 [Trifolium subterraneum] Length = 377 Score = 118 bits (296), Expect = 9e-30 Identities = 62/86 (72%), Positives = 67/86 (77%), Gaps = 1/86 (1%) Frame = -1 Query: 306 AADAAAAVLSGEYDNNMNGRIPERCGSMDKQF-GGTFETPVVGRYNGYVGSPGMVDELDD 130 AADAAAAVL+G YD N R+PERCGSMDK F GGTFETP VGRY+GYVGSPGMVD+LDD Sbjct: 293 AADAAAAVLAGGYDMNAAARVPERCGSMDKHFGGGTFETPGVGRYHGYVGSPGMVDDLDD 352 Query: 129 XXXXXXXXXXXGIRMFGDLWKKKGQK 52 GI+MFGDLWKKKGQK Sbjct: 353 -GFGGGKKKGSGIKMFGDLWKKKGQK 377 >gb|ACU21082.1| unknown [Glycine max] Length = 161 Score = 111 bits (278), Expect = 4e-29 Identities = 61/85 (71%), Positives = 64/85 (75%) Frame = -1 Query: 306 AADAAAAVLSGEYDNNMNGRIPERCGSMDKQFGGTFETPVVGRYNGYVGSPGMVDELDDX 127 AADAAAAVL+G D M+ RIPERCGSMDK FGGTFETP GRYNGYVGSPGM D+LDD Sbjct: 81 AADAAAAVLAGGVD--MSARIPERCGSMDKHFGGTFETP-AGRYNGYVGSPGMADDLDD- 136 Query: 126 XXXXXXXXXXGIRMFGDLWKKKGQK 52 GIRMFGDLWKKK QK Sbjct: 137 SFGGGKRKGSGIRMFGDLWKKKSQK 161 >ref|XP_016169836.1| interactor of constitutive active ROPs 4 [Arachis ipaensis] ref|XP_016169837.1| interactor of constitutive active ROPs 4 [Arachis ipaensis] Length = 386 Score = 115 bits (289), Expect = 1e-28 Identities = 63/85 (74%), Positives = 65/85 (76%) Frame = -1 Query: 306 AADAAAAVLSGEYDNNMNGRIPERCGSMDKQFGGTFETPVVGRYNGYVGSPGMVDELDDX 127 AADAAAAVL+G D +NGRIPERCGSMDK FGG FETP GRYNGYVGSPGM DELDD Sbjct: 306 AADAAAAVLAGGMD--INGRIPERCGSMDKHFGGNFETP-AGRYNGYVGSPGMADELDD- 361 Query: 126 XXXXXXXXXXGIRMFGDLWKKKGQK 52 GIRMFGDLWKKKGQK Sbjct: 362 GFGSVKRKGSGIRMFGDLWKKKGQK 386 >ref|XP_015933594.1| interactor of constitutive active ROPs 4 [Arachis duranensis] ref|XP_015933595.1| interactor of constitutive active ROPs 4 [Arachis duranensis] ref|XP_015933596.1| interactor of constitutive active ROPs 4 [Arachis duranensis] ref|XP_015933597.1| interactor of constitutive active ROPs 4 [Arachis duranensis] ref|XP_015933598.1| interactor of constitutive active ROPs 4 [Arachis duranensis] ref|XP_020983976.1| interactor of constitutive active ROPs 4 [Arachis duranensis] Length = 386 Score = 115 bits (289), Expect = 1e-28 Identities = 63/85 (74%), Positives = 65/85 (76%) Frame = -1 Query: 306 AADAAAAVLSGEYDNNMNGRIPERCGSMDKQFGGTFETPVVGRYNGYVGSPGMVDELDDX 127 AADAAAAVL+G D +NGRIPERCGSMDK FGG FETP GRYNGYVGSPGM DELDD Sbjct: 306 AADAAAAVLAGGMD--INGRIPERCGSMDKHFGGNFETP-AGRYNGYVGSPGMADELDD- 361 Query: 126 XXXXXXXXXXGIRMFGDLWKKKGQK 52 GIRMFGDLWKKKGQK Sbjct: 362 GFGSVKRKGSGIRMFGDLWKKKGQK 386 >gb|KYP38170.1| Interactor of constitutive active ROPs 4 [Cajanus cajan] Length = 161 Score = 110 bits (275), Expect = 1e-28 Identities = 60/85 (70%), Positives = 64/85 (75%) Frame = -1 Query: 306 AADAAAAVLSGEYDNNMNGRIPERCGSMDKQFGGTFETPVVGRYNGYVGSPGMVDELDDX 127 AADAAAAVL+G D M+ RIPERCGSMDK FGGTFETP GRYNGYVGSPGM D+LDD Sbjct: 81 AADAAAAVLAGGVD--MSARIPERCGSMDKHFGGTFETP-AGRYNGYVGSPGMADDLDD- 136 Query: 126 XXXXXXXXXXGIRMFGDLWKKKGQK 52 GIRMFGDLWKK+ QK Sbjct: 137 GFGSGKRKGSGIRMFGDLWKKRSQK 161 >ref|XP_013464384.1| interactor of constitutive active ROPs protein, putative [Medicago truncatula] gb|KEH38419.1| interactor of constitutive active ROPs protein, putative [Medicago truncatula] Length = 381 Score = 114 bits (285), Expect = 4e-28 Identities = 60/86 (69%), Positives = 66/86 (76%), Gaps = 1/86 (1%) Frame = -1 Query: 306 AADAAAAVLSGEYDNNMNGRIPERCGSMDKQF-GGTFETPVVGRYNGYVGSPGMVDELDD 130 AADAAAAVL+G +D + R+PERCGSMDK F GGTFETP GRY+GYVGSPGMVD+LDD Sbjct: 297 AADAAAAVLAGGFDMSAAARVPERCGSMDKHFVGGTFETPG-GRYHGYVGSPGMVDDLDD 355 Query: 129 XXXXXXXXXXXGIRMFGDLWKKKGQK 52 GIRMFGDLWKKKGQK Sbjct: 356 GFGSGKKKGSSGIRMFGDLWKKKGQK 381 >gb|PNY02400.1| interactor of constitutive active ROPS 1-like protein [Trifolium pratense] Length = 376 Score = 113 bits (282), Expect = 1e-27 Identities = 62/86 (72%), Positives = 66/86 (76%), Gaps = 1/86 (1%) Frame = -1 Query: 306 AADAAAAVLSGEYDNNMNGRIPERCGSMDKQF-GGTFETPVVGRYNGYVGSPGMVDELDD 130 AADAAAAVL+G +D N R+PERCGSMDK F GGTFETP VGRY GYVGSPGMVD+LDD Sbjct: 293 AADAAAAVLAGGFDMNAAARVPERCGSMDKHFGGGTFETPGVGRY-GYVGSPGMVDDLDD 351 Query: 129 XXXXXXXXXXXGIRMFGDLWKKKGQK 52 GIRMFGDLWKKKGQK Sbjct: 352 -GLGSGKKKGSGIRMFGDLWKKKGQK 376 >ref|XP_003626756.1| elongation factor 1-alpha [Medicago truncatula] gb|AET01232.1| elongation factor 1-alpha [Medicago truncatula] Length = 481 Score = 114 bits (285), Expect = 1e-27 Identities = 60/86 (69%), Positives = 66/86 (76%), Gaps = 1/86 (1%) Frame = -1 Query: 306 AADAAAAVLSGEYDNNMNGRIPERCGSMDKQFGG-TFETPVVGRYNGYVGSPGMVDELDD 130 AADAAAAVL+G +D + R+PERCGSMDK FGG TFETP GRY+GYVGSPGMVD+LDD Sbjct: 397 AADAAAAVLAGGFDMSAAARVPERCGSMDKHFGGGTFETPG-GRYHGYVGSPGMVDDLDD 455 Query: 129 XXXXXXXXXXXGIRMFGDLWKKKGQK 52 GIRMFGDLWKKKGQK Sbjct: 456 GFGSGKKKGSSGIRMFGDLWKKKGQK 481 >gb|PNX92292.1| interactor of constitutive active ROPS 1-like protein [Trifolium pratense] Length = 376 Score = 112 bits (281), Expect = 1e-27 Identities = 58/86 (67%), Positives = 65/86 (75%), Gaps = 1/86 (1%) Frame = -1 Query: 306 AADAAAAVLSGEYDNNMNGRIPERCGSMDKQFGG-TFETPVVGRYNGYVGSPGMVDELDD 130 AADAAA+VL+G +D + R+PERCGSMDK FGG TFETP VGRY GYVGSPGM+D+ DD Sbjct: 292 AADAAASVLAGGFDMSAASRVPERCGSMDKHFGGGTFETPGVGRYRGYVGSPGMIDDFDD 351 Query: 129 XXXXXXXXXXXGIRMFGDLWKKKGQK 52 GIRMFGDLWKKKGQK Sbjct: 352 -GFGGGKKKGSGIRMFGDLWKKKGQK 376 >gb|KHN29852.1| Interactor of constitutive active ROPs 1 [Glycine soja] Length = 380 Score = 111 bits (278), Expect = 4e-27 Identities = 61/85 (71%), Positives = 64/85 (75%) Frame = -1 Query: 306 AADAAAAVLSGEYDNNMNGRIPERCGSMDKQFGGTFETPVVGRYNGYVGSPGMVDELDDX 127 AADAAAAVL+G D M+ RIPERCGSMDK FGGTFETP GRYNGYVGSPGM D+LDD Sbjct: 300 AADAAAAVLAGGVD--MSARIPERCGSMDKHFGGTFETP-AGRYNGYVGSPGMADDLDD- 355 Query: 126 XXXXXXXXXXGIRMFGDLWKKKGQK 52 GIRMFGDLWKKK QK Sbjct: 356 GFGGGKRKGSGIRMFGDLWKKKSQK 380 >ref|XP_003546766.1| PREDICTED: interactor of constitutive active ROPs 4 [Glycine max] ref|XP_003546767.1| PREDICTED: interactor of constitutive active ROPs 4 [Glycine max] ref|XP_006598164.1| PREDICTED: interactor of constitutive active ROPs 4 [Glycine max] ref|XP_006598165.1| PREDICTED: interactor of constitutive active ROPs 4 [Glycine max] ref|XP_006598166.1| PREDICTED: interactor of constitutive active ROPs 4 [Glycine max] gb|KRH13582.1| hypothetical protein GLYMA_15G248900 [Glycine max] gb|KRH13583.1| hypothetical protein GLYMA_15G248900 [Glycine max] gb|KRH13584.1| hypothetical protein GLYMA_15G248900 [Glycine max] gb|KRH13585.1| hypothetical protein GLYMA_15G248900 [Glycine max] Length = 380 Score = 111 bits (278), Expect = 4e-27 Identities = 61/85 (71%), Positives = 64/85 (75%) Frame = -1 Query: 306 AADAAAAVLSGEYDNNMNGRIPERCGSMDKQFGGTFETPVVGRYNGYVGSPGMVDELDDX 127 AADAAAAVL+G D M+ RIPERCGSMDK FGGTFETP GRYNGYVGSPGM D+LDD Sbjct: 300 AADAAAAVLAGGVD--MSARIPERCGSMDKHFGGTFETP-AGRYNGYVGSPGMADDLDD- 355 Query: 126 XXXXXXXXXXGIRMFGDLWKKKGQK 52 GIRMFGDLWKKK QK Sbjct: 356 SFGGGKRKGSGIRMFGDLWKKKSQK 380 >ref|XP_020204184.1| interactor of constitutive active ROPs 4-like [Cajanus cajan] ref|XP_020204185.1| interactor of constitutive active ROPs 4-like [Cajanus cajan] ref|XP_020204186.1| interactor of constitutive active ROPs 4-like [Cajanus cajan] ref|XP_020204187.1| interactor of constitutive active ROPs 4-like [Cajanus cajan] ref|XP_020204188.1| interactor of constitutive active ROPs 4-like [Cajanus cajan] ref|XP_020204189.1| interactor of constitutive active ROPs 4-like [Cajanus cajan] ref|XP_020204190.1| interactor of constitutive active ROPs 4-like [Cajanus cajan] ref|XP_020204191.1| interactor of constitutive active ROPs 4-like [Cajanus cajan] ref|XP_020204193.1| interactor of constitutive active ROPs 4-like [Cajanus cajan] ref|XP_020204194.1| interactor of constitutive active ROPs 4-like [Cajanus cajan] Length = 375 Score = 110 bits (275), Expect = 1e-26 Identities = 60/85 (70%), Positives = 64/85 (75%) Frame = -1 Query: 306 AADAAAAVLSGEYDNNMNGRIPERCGSMDKQFGGTFETPVVGRYNGYVGSPGMVDELDDX 127 AADAAAAVL+G D M+ RIPERCGSMDK FGGTFETP GRYNGYVGSPGM D+LDD Sbjct: 295 AADAAAAVLAGGVD--MSARIPERCGSMDKHFGGTFETP-AGRYNGYVGSPGMADDLDD- 350 Query: 126 XXXXXXXXXXGIRMFGDLWKKKGQK 52 GIRMFGDLWKK+ QK Sbjct: 351 GFGSGKRKGSGIRMFGDLWKKRSQK 375 >ref|XP_019443794.1| PREDICTED: interactor of constitutive active ROPs 4-like [Lupinus angustifolius] ref|XP_019443795.1| PREDICTED: interactor of constitutive active ROPs 4-like [Lupinus angustifolius] ref|XP_019443796.1| PREDICTED: interactor of constitutive active ROPs 4-like [Lupinus angustifolius] ref|XP_019443797.1| PREDICTED: interactor of constitutive active ROPs 4-like [Lupinus angustifolius] ref|XP_019443798.1| PREDICTED: interactor of constitutive active ROPs 4-like [Lupinus angustifolius] ref|XP_019443799.1| PREDICTED: interactor of constitutive active ROPs 4-like [Lupinus angustifolius] gb|OIW11616.1| hypothetical protein TanjilG_31895 [Lupinus angustifolius] Length = 376 Score = 110 bits (274), Expect = 1e-26 Identities = 59/85 (69%), Positives = 64/85 (75%) Frame = -1 Query: 306 AADAAAAVLSGEYDNNMNGRIPERCGSMDKQFGGTFETPVVGRYNGYVGSPGMVDELDDX 127 AADAAAAVL+G+ D R+PERCGSMDK FGGTFETP GRYNGYVGSPGM D+LDD Sbjct: 298 AADAAAAVLAGDVDM----RVPERCGSMDKHFGGTFETP-AGRYNGYVGSPGMADDLDD- 351 Query: 126 XXXXXXXXXXGIRMFGDLWKKKGQK 52 G+RMFGDLWKKKGQK Sbjct: 352 GFGTGKRKGSGMRMFGDLWKKKGQK 376 >gb|KHN47479.1| Interactor of constitutive active ROPs 4 [Glycine soja] Length = 377 Score = 110 bits (274), Expect = 1e-26 Identities = 61/85 (71%), Positives = 63/85 (74%) Frame = -1 Query: 306 AADAAAAVLSGEYDNNMNGRIPERCGSMDKQFGGTFETPVVGRYNGYVGSPGMVDELDDX 127 AADAAAAVL+G D M+ RIPERCGSMDK FGGTFETP GRYNGYVGSPGM D LDD Sbjct: 297 AADAAAAVLAGGVD--MSARIPERCGSMDKHFGGTFETP-AGRYNGYVGSPGMADVLDD- 352 Query: 126 XXXXXXXXXXGIRMFGDLWKKKGQK 52 GIRMFGDLWKKK QK Sbjct: 353 GFGGGKRKGSGIRMFGDLWKKKSQK 377 >ref|XP_003543151.1| PREDICTED: interactor of constitutive active ROPs 4-like [Glycine max] ref|XP_003543152.1| PREDICTED: interactor of constitutive active ROPs 4-like [Glycine max] ref|XP_006594682.1| PREDICTED: interactor of constitutive active ROPs 4-like [Glycine max] ref|XP_006594683.1| PREDICTED: interactor of constitutive active ROPs 4-like [Glycine max] ref|XP_006594684.1| PREDICTED: interactor of constitutive active ROPs 4-like [Glycine max] ref|XP_006594685.1| PREDICTED: interactor of constitutive active ROPs 4-like [Glycine max] ref|XP_006594686.1| PREDICTED: interactor of constitutive active ROPs 4-like [Glycine max] ref|XP_014621348.1| PREDICTED: interactor of constitutive active ROPs 4-like [Glycine max] ref|XP_014621349.1| PREDICTED: interactor of constitutive active ROPs 4-like [Glycine max] ref|XP_014621350.1| PREDICTED: interactor of constitutive active ROPs 4-like [Glycine max] gb|KRH21789.1| hypothetical protein GLYMA_13G259200 [Glycine max] gb|KRH21790.1| hypothetical protein GLYMA_13G259200 [Glycine max] gb|KRH21791.1| hypothetical protein GLYMA_13G259200 [Glycine max] gb|KRH21792.1| hypothetical protein GLYMA_13G259200 [Glycine max] gb|KRH21793.1| hypothetical protein GLYMA_13G259200 [Glycine max] gb|KRH21794.1| hypothetical protein GLYMA_13G259200 [Glycine max] gb|KRH21795.1| hypothetical protein GLYMA_13G259200 [Glycine max] Length = 377 Score = 110 bits (274), Expect = 1e-26 Identities = 61/85 (71%), Positives = 63/85 (74%) Frame = -1 Query: 306 AADAAAAVLSGEYDNNMNGRIPERCGSMDKQFGGTFETPVVGRYNGYVGSPGMVDELDDX 127 AADAAAAVL+G D M+ RIPERCGSMDK FGGTFETP GRYNGYVGSPGM D LDD Sbjct: 297 AADAAAAVLAGGVD--MSARIPERCGSMDKHFGGTFETP-AGRYNGYVGSPGMADVLDD- 352 Query: 126 XXXXXXXXXXGIRMFGDLWKKKGQK 52 GIRMFGDLWKKK QK Sbjct: 353 GFGGGKRKGSGIRMFGDLWKKKSQK 377 >ref|XP_007149321.1| hypothetical protein PHAVU_005G060700g [Phaseolus vulgaris] gb|ESW21315.1| hypothetical protein PHAVU_005G060700g [Phaseolus vulgaris] Length = 380 Score = 110 bits (274), Expect = 1e-26 Identities = 60/85 (70%), Positives = 64/85 (75%) Frame = -1 Query: 306 AADAAAAVLSGEYDNNMNGRIPERCGSMDKQFGGTFETPVVGRYNGYVGSPGMVDELDDX 127 AADAAAAVL+G D M+ RIPERCGSMDK FGGTFETP GRYNGYVGSPGM D+LD+ Sbjct: 300 AADAAAAVLAGGVD--MSARIPERCGSMDKHFGGTFETP-AGRYNGYVGSPGMADDLDE- 355 Query: 126 XXXXXXXXXXGIRMFGDLWKKKGQK 52 GIRMFGDLWKKK QK Sbjct: 356 GFGGGKRKGSGIRMFGDLWKKKSQK 380 >ref|XP_017425622.1| PREDICTED: interactor of constitutive active ROPs 4 [Vigna angularis] ref|XP_017425623.1| PREDICTED: interactor of constitutive active ROPs 4 [Vigna angularis] ref|XP_017425624.1| PREDICTED: interactor of constitutive active ROPs 4 [Vigna angularis] gb|KOM42638.1| hypothetical protein LR48_Vigan05g024200 [Vigna angularis] dbj|BAT93240.1| hypothetical protein VIGAN_07217400 [Vigna angularis var. angularis] Length = 380 Score = 109 bits (273), Expect = 2e-26 Identities = 60/85 (70%), Positives = 63/85 (74%) Frame = -1 Query: 306 AADAAAAVLSGEYDNNMNGRIPERCGSMDKQFGGTFETPVVGRYNGYVGSPGMVDELDDX 127 AADAAAAVL+G D + RIPERCGSMDK FGGTFETP GRYNGYVGSPGM D+LDD Sbjct: 300 AADAAAAVLAGGVD--ITARIPERCGSMDKHFGGTFETP-AGRYNGYVGSPGMADDLDD- 355 Query: 126 XXXXXXXXXXGIRMFGDLWKKKGQK 52 GIRMFGDLWKKK QK Sbjct: 356 GFGGGKRKGSGIRMFGDLWKKKSQK 380 >ref|XP_014502149.1| interactor of constitutive active ROPs 4 [Vigna radiata var. radiata] ref|XP_014502150.1| interactor of constitutive active ROPs 4 [Vigna radiata var. radiata] ref|XP_014502152.1| interactor of constitutive active ROPs 4 [Vigna radiata var. radiata] ref|XP_022637074.1| interactor of constitutive active ROPs 4 [Vigna radiata var. radiata] ref|XP_022637075.1| interactor of constitutive active ROPs 4 [Vigna radiata var. radiata] Length = 380 Score = 107 bits (267), Expect = 2e-25 Identities = 59/85 (69%), Positives = 62/85 (72%) Frame = -1 Query: 306 AADAAAAVLSGEYDNNMNGRIPERCGSMDKQFGGTFETPVVGRYNGYVGSPGMVDELDDX 127 AADAAAAVL+G D + RIPERCGSMDK FGGTFETP RYNGYVGSPGM D+LDD Sbjct: 300 AADAAAAVLAGGVD--ITARIPERCGSMDKHFGGTFETP-AARYNGYVGSPGMADDLDD- 355 Query: 126 XXXXXXXXXXGIRMFGDLWKKKGQK 52 GIRMFGDLWKKK QK Sbjct: 356 GFGGGKRKGSGIRMFGDLWKKKSQK 380 >ref|XP_004488646.1| PREDICTED: interactor of constitutive active ROPs 4 [Cicer arietinum] ref|XP_004488647.1| PREDICTED: interactor of constitutive active ROPs 4 [Cicer arietinum] ref|XP_004488648.1| PREDICTED: interactor of constitutive active ROPs 4 [Cicer arietinum] ref|XP_004488649.1| PREDICTED: interactor of constitutive active ROPs 4 [Cicer arietinum] Length = 364 Score = 106 bits (265), Expect = 2e-25 Identities = 61/87 (70%), Positives = 65/87 (74%), Gaps = 2/87 (2%) Frame = -1 Query: 306 AADAAAAVLSGEYDNNMNGRIPERCGSMDKQFGGTFETP-VVGRYNGY-VGSPGMVDELD 133 AADAAAAVL+GE D N R+PERCGSMDK FGG FETP VGRYNGY VGSPGM ++LD Sbjct: 280 AADAAAAVLAGEMDMN-GSRVPERCGSMDKHFGGAFETPGGVGRYNGYVVGSPGMDNDLD 338 Query: 132 DXXXXXXXXXXXGIRMFGDLWKKKGQK 52 D GIRMFGDLWKKKGQK Sbjct: 339 D-GFGGGKKKGSGIRMFGDLWKKKGQK 364 >ref|XP_011006705.1| PREDICTED: interactor of constitutive active ROPs 4-like [Populus euphratica] ref|XP_011006706.1| PREDICTED: interactor of constitutive active ROPs 4-like [Populus euphratica] ref|XP_011006707.1| PREDICTED: interactor of constitutive active ROPs 4-like [Populus euphratica] ref|XP_011006708.1| PREDICTED: interactor of constitutive active ROPs 4-like [Populus euphratica] Length = 372 Score = 103 bits (256), Expect = 5e-24 Identities = 57/85 (67%), Positives = 62/85 (72%) Frame = -1 Query: 306 AADAAAAVLSGEYDNNMNGRIPERCGSMDKQFGGTFETPVVGRYNGYVGSPGMVDELDDX 127 AADAAAAVL+G + MNGRIPERCGSMDK FGG FE P VG Y G+VGSPGM D+LDD Sbjct: 292 AADAAAAVLAGGVE--MNGRIPERCGSMDKHFGGVFEPP-VGGYAGFVGSPGMADDLDD- 347 Query: 126 XXXXXXXXXXGIRMFGDLWKKKGQK 52 GI+ FGDLWKKKGQK Sbjct: 348 GFGSVKRKSSGIKKFGDLWKKKGQK 372