BLASTX nr result
ID: Astragalus23_contig00029663
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus23_contig00029663 (312 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KOM25439.1| hypothetical protein LR48_Vigan102s009700 [Vigna ... 52 9e-07 gb|ACU16688.1| unknown [Glycine max] 50 8e-06 >gb|KOM25439.1| hypothetical protein LR48_Vigan102s009700 [Vigna angularis] dbj|BAT86634.1| hypothetical protein VIGAN_04430600 [Vigna angularis var. angularis] Length = 79 Score = 52.4 bits (124), Expect = 9e-07 Identities = 24/38 (63%), Positives = 30/38 (78%) Frame = -2 Query: 116 ME*LSGDMHINGNKKDGNETKKDNSMNKNRHSTGLHVP 3 ME S DMH N NKK GNETK+D+ ++++R STGLHVP Sbjct: 1 MELASVDMHTNSNKKYGNETKEDDGVDQDRDSTGLHVP 38 >gb|ACU16688.1| unknown [Glycine max] Length = 70 Score = 49.7 bits (117), Expect = 8e-06 Identities = 20/31 (64%), Positives = 27/31 (87%) Frame = -2 Query: 95 MHINGNKKDGNETKKDNSMNKNRHSTGLHVP 3 MH N NKKDGNETK+D+ ++++R+ TGLHVP Sbjct: 1 MHTNSNKKDGNETKEDDCVDQDRNCTGLHVP 31