BLASTX nr result
ID: Astragalus23_contig00029591
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus23_contig00029591 (630 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GAU33333.1| hypothetical protein TSUD_165980 [Trifolium subt... 63 6e-08 gb|PNY06305.1| pentatricopeptide repeat-containing protein [Trif... 61 2e-07 ref|XP_012569571.1| PREDICTED: pentatricopeptide repeat-containi... 57 4e-06 ref|XP_012569570.1| PREDICTED: pentatricopeptide repeat-containi... 57 4e-06 ref|XP_012569569.1| PREDICTED: pentatricopeptide repeat-containi... 57 4e-06 ref|XP_012569568.1| PREDICTED: pentatricopeptide repeat-containi... 57 4e-06 ref|XP_004494545.1| PREDICTED: pentatricopeptide repeat-containi... 57 4e-06 >dbj|GAU33333.1| hypothetical protein TSUD_165980 [Trifolium subterraneum] Length = 501 Score = 62.8 bits (151), Expect = 6e-08 Identities = 42/90 (46%), Positives = 49/90 (54%), Gaps = 5/90 (5%) Frame = -3 Query: 256 MRSIYRAVIRDPS*ICYQTLASRNLFSSLACCHLTGARLLAYRTISRPYKYC*YCKNWQR 77 M+SIYRAV+RDPS I LASR LFSSLA CH R +R S+ + Sbjct: 1 MQSIYRAVVRDPSCIFCLPLASRTLFSSLATCHDAEGRDFRHREQSQDLTRSVDILTAKI 60 Query: 76 RQGGRHSSIY-----DETLEGIHLSQNLIN 2 +G I DET+ GIHLSQNLIN Sbjct: 61 GKGNSEEDILQTLISDETVSGIHLSQNLIN 90 >gb|PNY06305.1| pentatricopeptide repeat-containing protein [Trifolium pratense] Length = 537 Score = 61.2 bits (147), Expect = 2e-07 Identities = 41/90 (45%), Positives = 48/90 (53%), Gaps = 5/90 (5%) Frame = -3 Query: 256 MRSIYRAVIRDPS*ICYQTLASRNLFSSLACCHLTGARLLAYRTISRPYKYC*YCKNWQR 77 M+SIYRAV+ DPS IC LASR LFSSLA CH R +R S+ + Sbjct: 92 MQSIYRAVVHDPSCICCLPLASRTLFSSLATCHDAEGREFPHREQSQDLTRSVDILTAKI 151 Query: 76 RQGGR-----HSSIYDETLEGIHLSQNLIN 2 +G S I DE + GIH SQNLIN Sbjct: 152 GKGNSEEDILRSLISDEAVNGIHPSQNLIN 181 >ref|XP_012569571.1| PREDICTED: pentatricopeptide repeat-containing protein At3g04130, mitochondrial isoform X5 [Cicer arietinum] Length = 407 Score = 57.4 bits (137), Expect = 4e-06 Identities = 38/89 (42%), Positives = 48/89 (53%), Gaps = 5/89 (5%) Frame = -3 Query: 253 RSIYRAVIRDPS*ICYQTLASRNLFSSLACCHLTGARLLAYRTISRPYKYC*YCKNWQRR 74 +SIYRAV+RDPS ICY +SR LFSSL+ CH AR ++ S+ + Sbjct: 14 KSIYRAVVRDPSCICYLVYSSRTLFSSLSNCHHAEAREFWHKEQSQDLTRSVDILTAKIG 73 Query: 73 QGGR-----HSSIYDETLEGIHLSQNLIN 2 +G S I DE + IH SQNLIN Sbjct: 74 KGNSEEDILQSLISDEAVTDIHPSQNLIN 102 >ref|XP_012569570.1| PREDICTED: pentatricopeptide repeat-containing protein At3g04130, mitochondrial isoform X4 [Cicer arietinum] Length = 441 Score = 57.4 bits (137), Expect = 4e-06 Identities = 38/89 (42%), Positives = 48/89 (53%), Gaps = 5/89 (5%) Frame = -3 Query: 253 RSIYRAVIRDPS*ICYQTLASRNLFSSLACCHLTGARLLAYRTISRPYKYC*YCKNWQRR 74 +SIYRAV+RDPS ICY +SR LFSSL+ CH AR ++ S+ + Sbjct: 14 KSIYRAVVRDPSCICYLVYSSRTLFSSLSNCHHAEAREFWHKEQSQDLTRSVDILTAKIG 73 Query: 73 QGGR-----HSSIYDETLEGIHLSQNLIN 2 +G S I DE + IH SQNLIN Sbjct: 74 KGNSEEDILQSLISDEAVTDIHPSQNLIN 102 >ref|XP_012569569.1| PREDICTED: pentatricopeptide repeat-containing protein At3g04130, mitochondrial isoform X3 [Cicer arietinum] Length = 458 Score = 57.4 bits (137), Expect = 4e-06 Identities = 38/89 (42%), Positives = 48/89 (53%), Gaps = 5/89 (5%) Frame = -3 Query: 253 RSIYRAVIRDPS*ICYQTLASRNLFSSLACCHLTGARLLAYRTISRPYKYC*YCKNWQRR 74 +SIYRAV+RDPS ICY +SR LFSSL+ CH AR ++ S+ + Sbjct: 14 KSIYRAVVRDPSCICYLVYSSRTLFSSLSNCHHAEAREFWHKEQSQDLTRSVDILTAKIG 73 Query: 73 QGGR-----HSSIYDETLEGIHLSQNLIN 2 +G S I DE + IH SQNLIN Sbjct: 74 KGNSEEDILQSLISDEAVTDIHPSQNLIN 102 >ref|XP_012569568.1| PREDICTED: pentatricopeptide repeat-containing protein At3g04130, mitochondrial isoform X2 [Cicer arietinum] Length = 486 Score = 57.4 bits (137), Expect = 4e-06 Identities = 38/89 (42%), Positives = 48/89 (53%), Gaps = 5/89 (5%) Frame = -3 Query: 253 RSIYRAVIRDPS*ICYQTLASRNLFSSLACCHLTGARLLAYRTISRPYKYC*YCKNWQRR 74 +SIYRAV+RDPS ICY +SR LFSSL+ CH AR ++ S+ + Sbjct: 14 KSIYRAVVRDPSCICYLVYSSRTLFSSLSNCHHAEAREFWHKEQSQDLTRSVDILTAKIG 73 Query: 73 QGGR-----HSSIYDETLEGIHLSQNLIN 2 +G S I DE + IH SQNLIN Sbjct: 74 KGNSEEDILQSLISDEAVTDIHPSQNLIN 102 >ref|XP_004494545.1| PREDICTED: pentatricopeptide repeat-containing protein At3g04130, mitochondrial isoform X1 [Cicer arietinum] ref|XP_004494546.1| PREDICTED: pentatricopeptide repeat-containing protein At3g04130, mitochondrial isoform X1 [Cicer arietinum] Length = 513 Score = 57.4 bits (137), Expect = 4e-06 Identities = 38/89 (42%), Positives = 48/89 (53%), Gaps = 5/89 (5%) Frame = -3 Query: 253 RSIYRAVIRDPS*ICYQTLASRNLFSSLACCHLTGARLLAYRTISRPYKYC*YCKNWQRR 74 +SIYRAV+RDPS ICY +SR LFSSL+ CH AR ++ S+ + Sbjct: 14 KSIYRAVVRDPSCICYLVYSSRTLFSSLSNCHHAEAREFWHKEQSQDLTRSVDILTAKIG 73 Query: 73 QGGR-----HSSIYDETLEGIHLSQNLIN 2 +G S I DE + IH SQNLIN Sbjct: 74 KGNSEEDILQSLISDEAVTDIHPSQNLIN 102