BLASTX nr result
ID: Astragalus23_contig00029583
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus23_contig00029583 (447 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GAU21305.1| hypothetical protein TSUD_371990 [Trifolium subt... 103 9e-24 gb|PNY12231.1| putative exonuclease domain-containing protein [T... 103 3e-23 ref|XP_019464941.1| PREDICTED: uncharacterized exonuclease domai... 97 2e-21 ref|XP_004511251.1| PREDICTED: uncharacterized exonuclease domai... 97 2e-21 ref|XP_019464938.1| PREDICTED: uncharacterized exonuclease domai... 97 2e-21 ref|XP_003628533.1| histone mRNA exonuclease [Medicago truncatul... 96 5e-21 ref|XP_020203146.1| uncharacterized exonuclease domain-containin... 96 1e-20 gb|POF09852.1| putative exonuclease domain-containing protein [Q... 95 1e-20 gb|OIV99132.1| hypothetical protein TanjilG_22712 [Lupinus angus... 97 2e-20 gb|ACJ86298.1| unknown [Medicago truncatula] 94 2e-20 ref|XP_023912937.1| uncharacterized exonuclease domain-containin... 95 3e-20 ref|XP_007133161.1| hypothetical protein PHAVU_011G156700g [Phas... 92 3e-19 ref|XP_003527219.2| PREDICTED: uncharacterized exonuclease domai... 91 4e-19 ref|XP_015899160.1| PREDICTED: uncharacterized exonuclease domai... 89 2e-18 ref|XP_020993773.1| uncharacterized exonuclease domain-containin... 89 3e-18 ref|XP_016188788.1| uncharacterized exonuclease domain-containin... 89 3e-18 ref|XP_015954144.1| uncharacterized exonuclease domain-containin... 89 4e-18 ref|XP_010245564.1| PREDICTED: uncharacterized exonuclease domai... 89 5e-18 ref|XP_010245562.1| PREDICTED: uncharacterized exonuclease domai... 89 6e-18 ref|XP_018850204.1| PREDICTED: uncharacterized exonuclease domai... 87 1e-17 >dbj|GAU21305.1| hypothetical protein TSUD_371990 [Trifolium subterraneum] Length = 313 Score = 103 bits (257), Expect = 9e-24 Identities = 47/57 (82%), Positives = 53/57 (92%) Frame = +3 Query: 276 RPKHMCLYHTQGKCTKMDDLIHLEKFNHNCSGELQVNIAELNKVISQNLEFFLVLDL 446 R K MCLYHTQGKCTKMDDLIHL+KFNH+CS +LQVNIA+LNK+ SQNL+FFLVLDL Sbjct: 57 RSKPMCLYHTQGKCTKMDDLIHLDKFNHDCSRDLQVNIADLNKIRSQNLDFFLVLDL 113 >gb|PNY12231.1| putative exonuclease domain-containing protein [Trifolium pratense] Length = 424 Score = 103 bits (257), Expect = 3e-23 Identities = 47/57 (82%), Positives = 53/57 (92%) Frame = +3 Query: 276 RPKHMCLYHTQGKCTKMDDLIHLEKFNHNCSGELQVNIAELNKVISQNLEFFLVLDL 446 R K MCLYHTQGKCTKMDDLIHL+KFNH+CS +LQVNIA+LNK+ SQNL+FFLVLDL Sbjct: 66 RSKPMCLYHTQGKCTKMDDLIHLDKFNHDCSRDLQVNIADLNKIRSQNLDFFLVLDL 122 >ref|XP_019464941.1| PREDICTED: uncharacterized exonuclease domain-containing protein At3g15140 isoform X2 [Lupinus angustifolius] Length = 285 Score = 97.1 bits (240), Expect = 2e-21 Identities = 44/57 (77%), Positives = 50/57 (87%) Frame = +3 Query: 276 RPKHMCLYHTQGKCTKMDDLIHLEKFNHNCSGELQVNIAELNKVISQNLEFFLVLDL 446 R + MCLYHTQGKCT MDDL HLEKFNH+CS ELQVN ++LNK+ SQNL+FFLVLDL Sbjct: 53 RWRPMCLYHTQGKCTMMDDLTHLEKFNHDCSRELQVNTSDLNKICSQNLDFFLVLDL 109 >ref|XP_004511251.1| PREDICTED: uncharacterized exonuclease domain-containing protein At3g15140 [Cicer arietinum] Length = 307 Score = 97.4 bits (241), Expect = 2e-21 Identities = 45/57 (78%), Positives = 52/57 (91%) Frame = +3 Query: 276 RPKHMCLYHTQGKCTKMDDLIHLEKFNHNCSGELQVNIAELNKVISQNLEFFLVLDL 446 R K +CLYH+QGKCTKMDDLIHLEKFNH+ S ELQVNI+ELNK+ SQNL+FFL+LDL Sbjct: 52 RFKPICLYHSQGKCTKMDDLIHLEKFNHDSSRELQVNISELNKIRSQNLDFFLILDL 108 >ref|XP_019464938.1| PREDICTED: uncharacterized exonuclease domain-containing protein At3g15140 isoform X1 [Lupinus angustifolius] ref|XP_019464939.1| PREDICTED: uncharacterized exonuclease domain-containing protein At3g15140 isoform X1 [Lupinus angustifolius] Length = 309 Score = 97.1 bits (240), Expect = 2e-21 Identities = 44/57 (77%), Positives = 50/57 (87%) Frame = +3 Query: 276 RPKHMCLYHTQGKCTKMDDLIHLEKFNHNCSGELQVNIAELNKVISQNLEFFLVLDL 446 R + MCLYHTQGKCT MDDL HLEKFNH+CS ELQVN ++LNK+ SQNL+FFLVLDL Sbjct: 53 RWRPMCLYHTQGKCTMMDDLTHLEKFNHDCSRELQVNTSDLNKICSQNLDFFLVLDL 109 >ref|XP_003628533.1| histone mRNA exonuclease [Medicago truncatula] gb|AET03009.1| histone mRNA exonuclease [Medicago truncatula] Length = 308 Score = 96.3 bits (238), Expect = 5e-21 Identities = 45/57 (78%), Positives = 50/57 (87%) Frame = +3 Query: 276 RPKHMCLYHTQGKCTKMDDLIHLEKFNHNCSGELQVNIAELNKVISQNLEFFLVLDL 446 R K MCLYHTQGKCT MDDL+HL+KFNH+CS ELQVNIA L+KV SQN +FFLVLDL Sbjct: 53 RSKPMCLYHTQGKCTMMDDLVHLDKFNHDCSKELQVNIAGLSKVHSQNHDFFLVLDL 109 >ref|XP_020203146.1| uncharacterized exonuclease domain-containing protein At3g15140 [Cajanus cajan] ref|XP_020203147.1| uncharacterized exonuclease domain-containing protein At3g15140 [Cajanus cajan] Length = 313 Score = 95.5 bits (236), Expect = 1e-20 Identities = 57/120 (47%), Positives = 65/120 (54%) Frame = +3 Query: 87 MALQRASFLANNILSRCDPYXXXXXXXXXXXXXHPNFYSMXXXXXXXXXXXXXXXXXXXX 266 MAL RA ILS C+P HPN S+ Sbjct: 1 MALPRACLA--KILSHCNPMFLSLSPLTLH---HPNHLSLHTTHSCSLSASLSTSSLEPH 55 Query: 267 XXXRPKHMCLYHTQGKCTKMDDLIHLEKFNHNCSGELQVNIAELNKVISQNLEFFLVLDL 446 +P CLYH+QGKCTKMDD IHLE FNH+CS ELQVNIAELNK+ Q+L+FFLVLDL Sbjct: 56 SRWKPT--CLYHSQGKCTKMDDPIHLETFNHDCSNELQVNIAELNKIHPQDLDFFLVLDL 113 >gb|POF09852.1| putative exonuclease domain-containing protein [Quercus suber] Length = 294 Score = 94.7 bits (234), Expect = 1e-20 Identities = 44/57 (77%), Positives = 50/57 (87%) Frame = +3 Query: 276 RPKHMCLYHTQGKCTKMDDLIHLEKFNHNCSGELQVNIAELNKVISQNLEFFLVLDL 446 R K MCLY+TQGKCTKMDD IHLEKFNH+CS +L+VNIAEL + SQNL+FFLVLDL Sbjct: 35 RWKPMCLYYTQGKCTKMDDAIHLEKFNHDCSRDLEVNIAELKHIRSQNLDFFLVLDL 91 >gb|OIV99132.1| hypothetical protein TanjilG_22712 [Lupinus angustifolius] Length = 716 Score = 97.1 bits (240), Expect = 2e-20 Identities = 44/57 (77%), Positives = 50/57 (87%) Frame = +3 Query: 276 RPKHMCLYHTQGKCTKMDDLIHLEKFNHNCSGELQVNIAELNKVISQNLEFFLVLDL 446 R + MCLYHTQGKCT MDDL HLEKFNH+CS ELQVN ++LNK+ SQNL+FFLVLDL Sbjct: 460 RWRPMCLYHTQGKCTMMDDLTHLEKFNHDCSRELQVNTSDLNKICSQNLDFFLVLDL 516 >gb|ACJ86298.1| unknown [Medicago truncatula] Length = 252 Score = 93.6 bits (231), Expect = 2e-20 Identities = 43/53 (81%), Positives = 48/53 (90%) Frame = +3 Query: 288 MCLYHTQGKCTKMDDLIHLEKFNHNCSGELQVNIAELNKVISQNLEFFLVLDL 446 MCLYHTQGKCT MDDL+HL+KFNH+CS ELQVNIA L+KV SQN +FFLVLDL Sbjct: 1 MCLYHTQGKCTMMDDLVHLDKFNHDCSKELQVNIAGLSKVHSQNHDFFLVLDL 53 >ref|XP_023912937.1| uncharacterized exonuclease domain-containing protein At3g15140 [Quercus suber] Length = 336 Score = 94.7 bits (234), Expect = 3e-20 Identities = 44/57 (77%), Positives = 50/57 (87%) Frame = +3 Query: 276 RPKHMCLYHTQGKCTKMDDLIHLEKFNHNCSGELQVNIAELNKVISQNLEFFLVLDL 446 R K MCLY+TQGKCTKMDD IHLEKFNH+CS +L+VNIAEL + SQNL+FFLVLDL Sbjct: 77 RWKPMCLYYTQGKCTKMDDAIHLEKFNHDCSRDLEVNIAELKHIRSQNLDFFLVLDL 133 >ref|XP_007133161.1| hypothetical protein PHAVU_011G156700g [Phaseolus vulgaris] gb|ESW05155.1| hypothetical protein PHAVU_011G156700g [Phaseolus vulgaris] Length = 316 Score = 91.7 bits (226), Expect = 3e-19 Identities = 42/57 (73%), Positives = 49/57 (85%) Frame = +3 Query: 276 RPKHMCLYHTQGKCTKMDDLIHLEKFNHNCSGELQVNIAELNKVISQNLEFFLVLDL 446 R K +CLYH QGKCTKMDD IHLE FNH+CS +LQV+IAELNK+ QNL++FLVLDL Sbjct: 60 RWKPICLYHCQGKCTKMDDPIHLETFNHDCSSDLQVDIAELNKIRPQNLDYFLVLDL 116 >ref|XP_003527219.2| PREDICTED: uncharacterized exonuclease domain-containing protein At3g15140 isoform X1 [Glycine max] gb|KHN10373.1| Putative exonuclease domain-containing protein [Glycine soja] gb|KRH55169.1| hypothetical protein GLYMA_06G234800 [Glycine max] Length = 316 Score = 91.3 bits (225), Expect = 4e-19 Identities = 43/57 (75%), Positives = 48/57 (84%) Frame = +3 Query: 276 RPKHMCLYHTQGKCTKMDDLIHLEKFNHNCSGELQVNIAELNKVISQNLEFFLVLDL 446 R K MCLYH+QGKCTKMDD IHLE FNH+C EL VN AELNK+ SQ+L+FFLVLDL Sbjct: 60 RRKPMCLYHSQGKCTKMDDPIHLETFNHDCFRELLVNTAELNKIRSQDLDFFLVLDL 116 >ref|XP_015899160.1| PREDICTED: uncharacterized exonuclease domain-containing protein At3g15140 [Ziziphus jujuba] Length = 329 Score = 89.4 bits (220), Expect = 2e-18 Identities = 41/57 (71%), Positives = 49/57 (85%) Frame = +3 Query: 276 RPKHMCLYHTQGKCTKMDDLIHLEKFNHNCSGELQVNIAELNKVISQNLEFFLVLDL 446 R K MCLY+TQGKCTKMDD IHLEKFNH+CS +LQV++A LN + SQ L++FLVLDL Sbjct: 70 RWKPMCLYYTQGKCTKMDDPIHLEKFNHDCSRDLQVDVANLNSMHSQELDYFLVLDL 126 >ref|XP_020993773.1| uncharacterized exonuclease domain-containing protein At3g15140 isoform X2 [Arachis duranensis] Length = 290 Score = 88.6 bits (218), Expect = 3e-18 Identities = 40/57 (70%), Positives = 47/57 (82%) Frame = +3 Query: 276 RPKHMCLYHTQGKCTKMDDLIHLEKFNHNCSGELQVNIAELNKVISQNLEFFLVLDL 446 R K MCLYHTQGKC KMDD +H+E+FNH+CS ELQV AE +K+ SQN +FFLVLDL Sbjct: 61 RWKPMCLYHTQGKCNKMDDPVHIERFNHDCSRELQVASAERHKICSQNFDFFLVLDL 117 >ref|XP_016188788.1| uncharacterized exonuclease domain-containing protein At3g15140 [Arachis ipaensis] Length = 317 Score = 89.0 bits (219), Expect = 3e-18 Identities = 40/57 (70%), Positives = 48/57 (84%) Frame = +3 Query: 276 RPKHMCLYHTQGKCTKMDDLIHLEKFNHNCSGELQVNIAELNKVISQNLEFFLVLDL 446 R K MCLYHTQGKC+KMDD +H+E+FNH+CS ELQV AE +K+ SQN +FFLVLDL Sbjct: 61 RWKPMCLYHTQGKCSKMDDPVHIERFNHDCSRELQVASAEQHKICSQNFDFFLVLDL 117 >ref|XP_015954144.1| uncharacterized exonuclease domain-containing protein At3g15140 isoform X1 [Arachis duranensis] Length = 317 Score = 88.6 bits (218), Expect = 4e-18 Identities = 40/57 (70%), Positives = 47/57 (82%) Frame = +3 Query: 276 RPKHMCLYHTQGKCTKMDDLIHLEKFNHNCSGELQVNIAELNKVISQNLEFFLVLDL 446 R K MCLYHTQGKC KMDD +H+E+FNH+CS ELQV AE +K+ SQN +FFLVLDL Sbjct: 61 RWKPMCLYHTQGKCNKMDDPVHIERFNHDCSRELQVASAERHKICSQNFDFFLVLDL 117 >ref|XP_010245564.1| PREDICTED: uncharacterized exonuclease domain-containing protein At3g15140 isoform X2 [Nelumbo nucifera] Length = 357 Score = 89.0 bits (219), Expect = 5e-18 Identities = 41/57 (71%), Positives = 49/57 (85%) Frame = +3 Query: 276 RPKHMCLYHTQGKCTKMDDLIHLEKFNHNCSGELQVNIAELNKVISQNLEFFLVLDL 446 R K +CLY+TQGKCTKMDD +HLEKFNHNCS ELQVN A+L + SQ+L++FLVLDL Sbjct: 140 RWKPLCLYYTQGKCTKMDDPMHLEKFNHNCSTELQVNAAQLKHLRSQHLDYFLVLDL 196 >ref|XP_010245562.1| PREDICTED: uncharacterized exonuclease domain-containing protein At3g15140 isoform X1 [Nelumbo nucifera] Length = 399 Score = 89.0 bits (219), Expect = 6e-18 Identities = 41/57 (71%), Positives = 49/57 (85%) Frame = +3 Query: 276 RPKHMCLYHTQGKCTKMDDLIHLEKFNHNCSGELQVNIAELNKVISQNLEFFLVLDL 446 R K +CLY+TQGKCTKMDD +HLEKFNHNCS ELQVN A+L + SQ+L++FLVLDL Sbjct: 140 RWKPLCLYYTQGKCTKMDDPMHLEKFNHNCSTELQVNAAQLKHLRSQHLDYFLVLDL 196 >ref|XP_018850204.1| PREDICTED: uncharacterized exonuclease domain-containing protein At3g15140 [Juglans regia] Length = 329 Score = 87.4 bits (215), Expect = 1e-17 Identities = 41/57 (71%), Positives = 48/57 (84%) Frame = +3 Query: 276 RPKHMCLYHTQGKCTKMDDLIHLEKFNHNCSGELQVNIAELNKVISQNLEFFLVLDL 446 R K MCLY+TQGKCTKMDD IHL KFNH+CS +L+VNI+ L + SQNL+FFLVLDL Sbjct: 70 RWKPMCLYYTQGKCTKMDDAIHLGKFNHDCSRDLEVNISMLKCIPSQNLDFFLVLDL 126