BLASTX nr result
ID: Astragalus23_contig00029537
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus23_contig00029537 (300 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GAU18675.1| hypothetical protein TSUD_125080 [Trifolium subt... 55 1e-06 gb|KHN26299.1| Putative UPF0481 protein [Glycine soja] 55 2e-06 ref|XP_013442893.1| DUF247 domain protein [Medicago truncatula] ... 53 7e-06 >dbj|GAU18675.1| hypothetical protein TSUD_125080 [Trifolium subterraneum] Length = 478 Score = 55.5 bits (132), Expect = 1e-06 Identities = 36/101 (35%), Positives = 57/101 (56%), Gaps = 3/101 (2%) Frame = -1 Query: 294 NPGQELRKNERILGDLTLLENQIPLFILKTLFKQVFTEGKISHTLMNNLSLSVLFGFDPN 115 +PG E++K E ++ DL LLENQIP+FIL+TLF+++ + NL+L LFG+ Sbjct: 157 SPGIEVKKMEYVVSDLMLLENQIPIFILETLFEKLLGSSNQMREFIQNLALP-LFGYSGK 215 Query: 114 LRDDYVRFQKHGPFSHFIHTAARFYMEIKY---PHDDDDDD 1 L SHF+ A Y+E+++ P +++D D Sbjct: 216 LMGRST--------SHFLDVAYS-YIEMEWTDKPGEENDTD 247 >gb|KHN26299.1| Putative UPF0481 protein [Glycine soja] Length = 503 Score = 54.7 bits (130), Expect = 2e-06 Identities = 28/58 (48%), Positives = 42/58 (72%), Gaps = 4/58 (6%) Frame = -1 Query: 294 NPGQELRKNERILGDLTLLENQIPLFILK----TLFKQVFTEGKISHTLMNNLSLSVL 133 +PG E+ K E++L DLT++ENQIPL +LK LF ++FT+G + L+ NL+LS+L Sbjct: 111 SPGAEVIKREKVLSDLTMMENQIPLIVLKRISGILFPEIFTDGG-TDKLIQNLALSIL 167 >ref|XP_013442893.1| DUF247 domain protein [Medicago truncatula] gb|KEH16918.1| DUF247 domain protein [Medicago truncatula] Length = 483 Score = 53.1 bits (126), Expect = 7e-06 Identities = 28/61 (45%), Positives = 40/61 (65%) Frame = -1 Query: 294 NPGQELRKNERILGDLTLLENQIPLFILKTLFKQVFTEGKISHTLMNNLSLSVLFGFDPN 115 +PG E++K E ++ DL LLENQIP+FIL+TLF+ + L+ NL+L LF + P Sbjct: 163 SPGIEVKKMEYVITDLMLLENQIPIFILETLFENLIGPSPKMRELIQNLTLP-LFRYSPK 221 Query: 114 L 112 L Sbjct: 222 L 222