BLASTX nr result
ID: Astragalus23_contig00029529
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus23_contig00029529 (377 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KYP40844.1| hypothetical protein KK1_037800, partial [Cajanus... 63 1e-10 ref|XP_006596771.1| PREDICTED: uncharacterized mitochondrial pro... 65 2e-10 gb|KYP62479.1| Retrovirus-related Pol polyprotein from transposo... 65 5e-10 dbj|GAU32278.1| hypothetical protein TSUD_62940 [Trifolium subte... 66 6e-10 gb|KYP63565.1| hypothetical protein KK1_018144, partial [Cajanus... 61 7e-10 gb|KYP53110.1| Retrovirus-related Pol polyprotein from transposo... 64 9e-10 gb|PNX93462.1| histone deacetylase, partial [Trifolium pratense] 64 2e-09 ref|XP_014634014.1| PREDICTED: uncharacterized mitochondrial pro... 62 4e-09 gb|KYP52262.1| hypothetical protein KK1_025866 [Cajanus cajan] 59 5e-09 gb|KYP36081.1| hypothetical protein KK1_042830, partial [Cajanus... 59 6e-09 gb|KYP63867.1| hypothetical protein KK1_018453, partial [Cajanus... 60 6e-09 dbj|GAU31266.1| hypothetical protein TSUD_153410 [Trifolium subt... 62 1e-08 gb|KYP61010.1| Retrovirus-related Pol polyprotein from transposo... 60 1e-08 ref|XP_020203528.1| uncharacterized protein LOC109789074 [Cajanu... 59 1e-08 gb|KYP47094.1| Callose synthase 9 [Cajanus cajan] 62 2e-08 gb|KYP52906.1| hypothetical protein KK1_025106, partial [Cajanus... 60 2e-08 gb|KYP33384.1| hypothetical protein KK1_045765 [Cajanus cajan] 59 3e-08 ref|XP_020207757.1| uncharacterized protein LOC109792735 [Cajanu... 59 3e-08 gb|PNY02745.1| hypothetical protein L195_g026064 [Trifolium prat... 61 3e-08 ref|XP_020231176.1| uncharacterized protein LOC109811762 [Cajanu... 60 4e-08 >gb|KYP40844.1| hypothetical protein KK1_037800, partial [Cajanus cajan] Length = 68 Score = 62.8 bits (151), Expect = 1e-10 Identities = 28/48 (58%), Positives = 40/48 (83%) Frame = +2 Query: 134 LTGNFPALIQSITSKLNNVFALKQLGDLDYFLGIKVKKQSNGTLLLTR 277 +TGN +++QS SKLN VFA KQLGDLDYFLGI+VK+ ++G+++L + Sbjct: 12 VTGNSHSVVQSFISKLNGVFAFKQLGDLDYFLGIEVKRTNSGSVILNQ 59 >ref|XP_006596771.1| PREDICTED: uncharacterized mitochondrial protein AtMg00810-like [Glycine max] Length = 176 Score = 64.7 bits (156), Expect = 2e-10 Identities = 30/49 (61%), Positives = 39/49 (79%) Frame = +2 Query: 134 LTGNFPALIQSITSKLNNVFALKQLGDLDYFLGIKVKKQSNGTLLLTRT 280 LTG+ P+LIQ IT KLN F+LKQLG LDYFLG+K+K N ++L+T+T Sbjct: 51 LTGSSPSLIQQITYKLNTAFSLKQLGHLDYFLGLKIKYLPNSSILMTQT 99 >gb|KYP62479.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cajanus cajan] Length = 293 Score = 65.5 bits (158), Expect = 5e-10 Identities = 30/48 (62%), Positives = 41/48 (85%) Frame = +2 Query: 134 LTGNFPALIQSITSKLNNVFALKQLGDLDYFLGIKVKKQSNGTLLLTR 277 +TGN +L+QS SKLN VFALKQLGDLDYFLGI+VK+ ++G+++L + Sbjct: 223 VTGNSHSLVQSFISKLNGVFALKQLGDLDYFLGIEVKRTNSGSVILNQ 270 >dbj|GAU32278.1| hypothetical protein TSUD_62940 [Trifolium subterraneum] Length = 1409 Score = 65.9 bits (159), Expect = 6e-10 Identities = 31/49 (63%), Positives = 44/49 (89%) Frame = +2 Query: 134 LTGNFPALIQSITSKLNNVFALKQLGDLDYFLGIKVKKQSNGTLLLTRT 280 +TG+ PALIQS+ KL++VF+LKQLGDL+YFLGI+VK+ S+ +LLLT++ Sbjct: 1123 ITGSSPALIQSLVEKLHSVFSLKQLGDLEYFLGIEVKQLSDQSLLLTQS 1171 >gb|KYP63565.1| hypothetical protein KK1_018144, partial [Cajanus cajan] Length = 69 Score = 60.8 bits (146), Expect = 7e-10 Identities = 31/49 (63%), Positives = 38/49 (77%) Frame = +2 Query: 134 LTGNFPALIQSITSKLNNVFALKQLGDLDYFLGIKVKKQSNGTLLLTRT 280 LT N P+LIQ +TS LN+ FALKQLG LDYFLGIKV + +LL+T+T Sbjct: 13 LTNNSPSLIQKLTSHLNSKFALKQLGLLDYFLGIKVNHLHDKSLLMTQT 61 >gb|KYP53110.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94, partial [Cajanus cajan] Length = 220 Score = 63.9 bits (154), Expect = 9e-10 Identities = 39/90 (43%), Positives = 51/90 (56%) Frame = +2 Query: 23 TNKVQMKFLI*TYKKIDNWIYLRIIP*NTL*HKVATYLTGNFPALIQSITSKLNNVFALK 202 TNK + YK N IYL L + T LT + L+Q + +LN VFALK Sbjct: 30 TNKYDPSIFMYKYKS--NVIYL-------LFYTDGTILTSDSQQLLQQLNLQLNGVFALK 80 Query: 203 QLGDLDYFLGIKVKKQSNGTLLLTRTN*VH 292 QLGDL+YFLGIKV K NG+++ T+ +H Sbjct: 81 QLGDLEYFLGIKVHKLKNGSIVFTQKKYIH 110 >gb|PNX93462.1| histone deacetylase, partial [Trifolium pratense] Length = 1489 Score = 64.3 bits (155), Expect = 2e-09 Identities = 29/49 (59%), Positives = 43/49 (87%) Frame = +2 Query: 134 LTGNFPALIQSITSKLNNVFALKQLGDLDYFLGIKVKKQSNGTLLLTRT 280 +TG+ P L+Q + +KL++VF+LKQLG+L+YFLGI+VK S+G+LLLT+T Sbjct: 1178 ITGSSPDLVQHLVNKLDSVFSLKQLGELEYFLGIEVKNLSDGSLLLTQT 1226 >ref|XP_014634014.1| PREDICTED: uncharacterized mitochondrial protein AtMg00810-like [Glycine max] Length = 177 Score = 61.6 bits (148), Expect = 4e-09 Identities = 30/48 (62%), Positives = 40/48 (83%) Frame = +2 Query: 134 LTGNFPALIQSITSKLNNVFALKQLGDLDYFLGIKVKKQSNGTLLLTR 277 +TG+ LIQ + +KL+ VFALKQLG+LDYFLGI+VK SNG+LLL++ Sbjct: 75 ITGSSSVLIQKLITKLHAVFALKQLGNLDYFLGIEVKHLSNGSLLLSQ 122 >gb|KYP52262.1| hypothetical protein KK1_025866 [Cajanus cajan] Length = 65 Score = 58.5 bits (140), Expect = 5e-09 Identities = 27/48 (56%), Positives = 38/48 (79%) Frame = +2 Query: 134 LTGNFPALIQSITSKLNNVFALKQLGDLDYFLGIKVKKQSNGTLLLTR 277 +TGN +L+QS SKLN FALK+L DLDYFLGI+VK ++G+++L + Sbjct: 10 ITGNSHSLVQSFISKLNGAFALKKLSDLDYFLGIEVKCTNSGSVILNQ 57 >gb|KYP36081.1| hypothetical protein KK1_042830, partial [Cajanus cajan] Length = 87 Score = 58.9 bits (141), Expect = 6e-09 Identities = 26/49 (53%), Positives = 39/49 (79%) Frame = +2 Query: 134 LTGNFPALIQSITSKLNNVFALKQLGDLDYFLGIKVKKQSNGTLLLTRT 280 + GN ++QS+ S+L+ F+LK LGDLDYFLGI+VK Q +G+L+LT++ Sbjct: 33 IAGNNSTVLQSLVSRLHPAFSLKDLGDLDYFLGIEVKNQPDGSLILTQS 81 >gb|KYP63867.1| hypothetical protein KK1_018453, partial [Cajanus cajan] Length = 133 Score = 60.1 bits (144), Expect = 6e-09 Identities = 28/48 (58%), Positives = 37/48 (77%) Frame = +2 Query: 134 LTGNFPALIQSITSKLNNVFALKQLGDLDYFLGIKVKKQSNGTLLLTR 277 LTGN P+L+Q ++LN +F+LK LG LDYFLGI+VK S G LLL++ Sbjct: 36 LTGNSPSLLQKFVTQLNAIFSLKDLGTLDYFLGIEVKSLSQGKLLLSQ 83 >dbj|GAU31266.1| hypothetical protein TSUD_153410 [Trifolium subterraneum] Length = 844 Score = 62.4 bits (150), Expect = 1e-08 Identities = 29/49 (59%), Positives = 39/49 (79%) Frame = +2 Query: 134 LTGNFPALIQSITSKLNNVFALKQLGDLDYFLGIKVKKQSNGTLLLTRT 280 + G+ P L+Q + KL+ VF+LKQLGDLDYFLGI+VK +G+LLLT+T Sbjct: 533 IIGSSPTLVQHLVDKLDAVFSLKQLGDLDYFLGIEVKHLKDGSLLLTQT 581 >gb|KYP61010.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cajanus cajan] Length = 172 Score = 60.1 bits (144), Expect = 1e-08 Identities = 29/57 (50%), Positives = 43/57 (75%) Frame = +2 Query: 134 LTGNFPALIQSITSKLNNVFALKQLGDLDYFLGIKVKKQSNGTLLLTRTN*VH*KIF 304 +TGN LIQ IT++L+++F+LKQLG LDYFLGI+VK N +L+LT++ + +F Sbjct: 75 ITGNSSLLIQQITNQLDSIFSLKQLGSLDYFLGIEVKHLPNKSLVLTQSKYIRDLLF 131 >ref|XP_020203528.1| uncharacterized protein LOC109789074 [Cajanus cajan] Length = 141 Score = 59.3 bits (142), Expect = 1e-08 Identities = 27/49 (55%), Positives = 39/49 (79%) Frame = +2 Query: 134 LTGNFPALIQSITSKLNNVFALKQLGDLDYFLGIKVKKQSNGTLLLTRT 280 +TGN A +++I S+LN+ F+LK LG LDYFLGI+VK S+G+L LT++ Sbjct: 44 ITGNNTAFLRNIVSQLNSAFSLKDLGQLDYFLGIEVKSNSDGSLTLTQS 92 >gb|KYP47094.1| Callose synthase 9 [Cajanus cajan] Length = 857 Score = 61.6 bits (148), Expect = 2e-08 Identities = 37/88 (42%), Positives = 54/88 (61%) Frame = +2 Query: 14 LIYTNKVQMKFLI*TYKKIDNWIYLRIIP*NTL*HKVATYLTGNFPALIQSITSKLNNVF 193 L Y+ V + L YK IYL + + + L+G+ L+Q +T +LN+VF Sbjct: 194 LKYSQPVSVILLCVIYKHNSIVIYLLVYVDDII-------LSGSSQKLLQHLTLQLNDVF 246 Query: 194 ALKQLGDLDYFLGIKVKKQSNGTLLLTR 277 ALKQLGDL+YFLGI+V+ NG++LLT+ Sbjct: 247 ALKQLGDLEYFLGIEVQSLKNGSMLLTQ 274 >gb|KYP52906.1| hypothetical protein KK1_025106, partial [Cajanus cajan] gb|KYP52908.1| hypothetical protein KK1_025108, partial [Cajanus cajan] Length = 227 Score = 60.5 bits (145), Expect = 2e-08 Identities = 28/48 (58%), Positives = 38/48 (79%) Frame = +2 Query: 134 LTGNFPALIQSITSKLNNVFALKQLGDLDYFLGIKVKKQSNGTLLLTR 277 LTGN P+L+Q ++LN +F+LK LG LDYFLGI+VK S+G LLL++ Sbjct: 41 LTGNSPSLLQKFVTQLNAIFSLKDLGTLDYFLGIEVKSLSHGKLLLSQ 88 >gb|KYP33384.1| hypothetical protein KK1_045765 [Cajanus cajan] Length = 136 Score = 58.5 bits (140), Expect = 3e-08 Identities = 26/49 (53%), Positives = 41/49 (83%) Frame = +2 Query: 134 LTGNFPALIQSITSKLNNVFALKQLGDLDYFLGIKVKKQSNGTLLLTRT 280 +TGN A++ ++ S+L++VF+LK LGDLDYFL I+ K QS+G+L+LT++ Sbjct: 45 ITGNNSAILHTLVSQLHSVFSLKDLGDLDYFLAIEGKTQSDGSLILTQS 93 >ref|XP_020207757.1| uncharacterized protein LOC109792735 [Cajanus cajan] Length = 138 Score = 58.5 bits (140), Expect = 3e-08 Identities = 26/49 (53%), Positives = 41/49 (83%) Frame = +2 Query: 134 LTGNFPALIQSITSKLNNVFALKQLGDLDYFLGIKVKKQSNGTLLLTRT 280 +TGN A++ ++ S+L++VF+LK LGDLDYFL I+ K QS+G+L+LT++ Sbjct: 47 ITGNNSAILHTLVSQLHSVFSLKDLGDLDYFLAIEGKTQSDGSLILTQS 95 >gb|PNY02745.1| hypothetical protein L195_g026064 [Trifolium pratense] Length = 337 Score = 60.8 bits (146), Expect = 3e-08 Identities = 32/75 (42%), Positives = 51/75 (68%) Frame = +2 Query: 56 TYKKIDNWIYLRIIP*NTL*HKVATYLTGNFPALIQSITSKLNNVFALKQLGDLDYFLGI 235 TY K +YL + + + +TG+ +L+ S+ KL+++F+LKQLGDLDYFLGI Sbjct: 56 TYTKHKQVVYLLVYVDDII-------ITGSSLSLVHSLVQKLDSIFSLKQLGDLDYFLGI 108 Query: 236 KVKKQSNGTLLLTRT 280 +VK+ S+ +LLLT++ Sbjct: 109 EVKQLSDNSLLLTQS 123 >ref|XP_020231176.1| uncharacterized protein LOC109811762 [Cajanus cajan] Length = 320 Score = 60.5 bits (145), Expect = 4e-08 Identities = 28/48 (58%), Positives = 38/48 (79%) Frame = +2 Query: 134 LTGNFPALIQSITSKLNNVFALKQLGDLDYFLGIKVKKQSNGTLLLTR 277 LTGN P+L+Q + +LN +F+LK LG LDYFLGI+VK S+G LLL++ Sbjct: 92 LTGNSPSLLQKLIDQLNEIFSLKDLGTLDYFLGIEVKPISDGRLLLSQ 139