BLASTX nr result
ID: Astragalus23_contig00029281
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus23_contig00029281 (342 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFK35718.1| unknown [Medicago truncatula] 66 3e-12 gb|KHN17134.1| hypothetical protein glysoja_011608 [Glycine soja... 59 3e-09 >gb|AFK35718.1| unknown [Medicago truncatula] Length = 56 Score = 66.2 bits (160), Expect = 3e-12 Identities = 36/58 (62%), Positives = 42/58 (72%), Gaps = 3/58 (5%) Frame = +3 Query: 30 MVPITTYFVLFISSVLYVFWDARVALEDLASHQARL---SPSLSYSSFHYQLDAPIIL 194 MVPIT+YF+LFISSV YVFWDAR+ LED AS + RL S S Y+ H LD PII+ Sbjct: 1 MVPITSYFLLFISSVFYVFWDARILLEDYASQRDRLHFQSSSFGYTISH--LDVPIIM 56 >gb|KHN17134.1| hypothetical protein glysoja_011608 [Glycine soja] gb|KRH34877.1| hypothetical protein GLYMA_10G211100 [Glycine max] Length = 55 Score = 58.5 bits (140), Expect = 3e-09 Identities = 32/57 (56%), Positives = 39/57 (68%), Gaps = 2/57 (3%) Frame = +3 Query: 30 MVPITTYFVLFISSVLYVFWDARVALEDLASHQARLSP--SLSYSSFHYQLDAPIIL 194 M PITTYF++ +SSV YVFWDARVALE+ H P SLSYS H++ PI+L Sbjct: 1 MAPITTYFLILMSSVFYVFWDARVALEEFTVHDHLGFPMSSLSYSLNHHEY--PILL 55