BLASTX nr result
ID: Astragalus23_contig00028385
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus23_contig00028385 (476 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GAU43311.1| hypothetical protein TSUD_390100 [Trifolium subt... 57 2e-07 ref|XP_003593104.1| hypothetical protein MTR_2g007860 [Medicago ... 55 8e-07 gb|PNX55467.1| hypothetical protein L195_g049096 [Trifolium prat... 54 3e-06 gb|KRH43981.1| hypothetical protein GLYMA_08G183800 [Glycine max] 52 7e-06 >dbj|GAU43311.1| hypothetical protein TSUD_390100 [Trifolium subterraneum] Length = 117 Score = 56.6 bits (135), Expect = 2e-07 Identities = 29/40 (72%), Positives = 32/40 (80%), Gaps = 3/40 (7%) Frame = +1 Query: 193 IEDVLAEIEEDERLRRKIKRFRYVHDLYNVTHVL---PPS 303 +EDVLAEIEEDERLRRK KRFRY+ DLY VT + PPS Sbjct: 74 VEDVLAEIEEDERLRRKNKRFRYIEDLYRVTVPIVNTPPS 113 >ref|XP_003593104.1| hypothetical protein MTR_2g007860 [Medicago truncatula] gb|AES63355.1| hypothetical protein MTR_2g007860 [Medicago truncatula] Length = 115 Score = 55.1 bits (131), Expect = 8e-07 Identities = 27/39 (69%), Positives = 32/39 (82%), Gaps = 3/39 (7%) Frame = +1 Query: 193 IEDVLAEIEEDERLRRKIKRFRYVHDLYNVTH---VLPP 300 +EDVLAEIEEDERLRRK KRFRYV ++Y VT ++PP Sbjct: 73 VEDVLAEIEEDERLRRKNKRFRYVEEVYRVTDPIVIVPP 111 >gb|PNX55467.1| hypothetical protein L195_g049096 [Trifolium pratense] Length = 107 Score = 53.5 bits (127), Expect = 3e-06 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = +1 Query: 193 IEDVLAEIEEDERLRRKIKRFRYVHDLYNVT 285 IEDVLA+IEEDERLRRK KR RYV DLY VT Sbjct: 69 IEDVLADIEEDERLRRKKKRIRYVEDLYRVT 99 >gb|KRH43981.1| hypothetical protein GLYMA_08G183800 [Glycine max] Length = 76 Score = 51.6 bits (122), Expect = 7e-06 Identities = 22/34 (64%), Positives = 28/34 (82%) Frame = +1 Query: 193 IEDVLAEIEEDERLRRKIKRFRYVHDLYNVTHVL 294 +ED+LAEIEEDER RR+ R+R++ DLYNVT L Sbjct: 37 VEDILAEIEEDERFRRRNSRYRFIQDLYNVTQPL 70