BLASTX nr result
ID: Astragalus23_contig00028306
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus23_contig00028306 (685 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_016198297.1| tetraspanin-6-like [Arachis ipaensis] 99 5e-21 ref|XP_015960493.1| tetraspanin-6-like [Arachis duranensis] 99 5e-21 dbj|GAU51569.1| hypothetical protein TSUD_287200 [Trifolium subt... 96 5e-21 ref|XP_013451628.1| tetraspanin family protein [Medicago truncat... 98 6e-21 ref|XP_003548017.1| PREDICTED: tetraspanin-6 [Glycine max] >gi|7... 96 3e-20 ref|XP_017439299.1| PREDICTED: tetraspanin-6-like [Vigna angular... 94 2e-19 ref|XP_014506970.1| tetraspanin-6 [Vigna radiata var. radiata] 94 2e-19 ref|XP_007151754.1| hypothetical protein PHAVU_004G071900g [Phas... 94 2e-19 ref|XP_004515993.1| PREDICTED: tetraspanin-6-like [Cicer arietinum] 94 3e-19 ref|XP_021663989.1| tetraspanin-6-like [Hevea brasiliensis] 94 3e-19 ref|XP_003518112.1| PREDICTED: tetraspanin-6-like [Glycine max] ... 94 3e-19 ref|XP_020208472.1| tetraspanin-6-like [Cajanus cajan] >gi|10123... 93 5e-19 ref|XP_019465023.1| PREDICTED: tetraspanin-6-like [Lupinus angus... 91 5e-18 gb|AFK42255.1| unknown [Medicago truncatula] 90 6e-18 ref|XP_003591945.1| tetraspanin family protein [Medicago truncat... 90 6e-18 gb|PKI74607.1| hypothetical protein CRG98_004934 [Punica granatum] 90 9e-18 ref|XP_021626449.1| tetraspanin-6-like [Manihot esculenta] >gi|1... 88 3e-17 ref|XP_010937833.1| PREDICTED: tetraspanin-6 [Elaeis guineensis] 88 3e-17 gb|KHN00831.1| hypothetical protein glysoja_000499 [Glycine soja] 87 6e-17 ref|XP_012460703.1| PREDICTED: tetraspanin-6 [Gossypium raimondi... 87 9e-17 >ref|XP_016198297.1| tetraspanin-6-like [Arachis ipaensis] Length = 286 Score = 98.6 bits (244), Expect = 5e-21 Identities = 39/43 (90%), Positives = 41/43 (95%) Frame = +3 Query: 3 CAFRNARRAESHYPHGENRMTKVKPRWDYYCWRWWHDKKEQLF 131 CAFRNARRAES YPHG NRMTKV+PRWDYYCWRWW+DKKEQLF Sbjct: 244 CAFRNARRAESDYPHGHNRMTKVRPRWDYYCWRWWYDKKEQLF 286 >ref|XP_015960493.1| tetraspanin-6-like [Arachis duranensis] Length = 286 Score = 98.6 bits (244), Expect = 5e-21 Identities = 39/43 (90%), Positives = 41/43 (95%) Frame = +3 Query: 3 CAFRNARRAESHYPHGENRMTKVKPRWDYYCWRWWHDKKEQLF 131 CAFRNARRAES YPHG NRMTKV+PRWDYYCWRWW+DKKEQLF Sbjct: 244 CAFRNARRAESDYPHGHNRMTKVRPRWDYYCWRWWYDKKEQLF 286 >dbj|GAU51569.1| hypothetical protein TSUD_287200 [Trifolium subterraneum] Length = 181 Score = 95.9 bits (237), Expect = 5e-21 Identities = 36/43 (83%), Positives = 42/43 (97%) Frame = +3 Query: 3 CAFRNARRAESHYPHGENRMTKVKPRWDYYCWRWWHDKKEQLF 131 CAFRN+RRA++ YPHGENRM+KV+PRWDY+CWRWWHDKKEQLF Sbjct: 139 CAFRNSRRAQTDYPHGENRMSKVRPRWDYHCWRWWHDKKEQLF 181 >ref|XP_013451628.1| tetraspanin family protein [Medicago truncatula] gb|AFK37296.1| unknown [Medicago truncatula] gb|KEH25656.1| tetraspanin family protein [Medicago truncatula] Length = 283 Score = 98.2 bits (243), Expect = 6e-21 Identities = 38/43 (88%), Positives = 41/43 (95%) Frame = +3 Query: 3 CAFRNARRAESHYPHGENRMTKVKPRWDYYCWRWWHDKKEQLF 131 CAFRNARR+E+ YPHGENRM KV+PRWDYYCWRWWHDKKEQLF Sbjct: 241 CAFRNARRSETDYPHGENRMRKVRPRWDYYCWRWWHDKKEQLF 283 >ref|XP_003548017.1| PREDICTED: tetraspanin-6 [Glycine max] gb|KHN13368.1| hypothetical protein glysoja_026798 [Glycine soja] gb|KRH08379.1| hypothetical protein GLYMA_16G145400 [Glycine max] Length = 283 Score = 96.3 bits (238), Expect = 3e-20 Identities = 37/43 (86%), Positives = 42/43 (97%) Frame = +3 Query: 3 CAFRNARRAESHYPHGENRMTKVKPRWDYYCWRWWHDKKEQLF 131 CAFRNARRA++ YPHGENRMTKVKPRWDYYCWRWW++KKE+LF Sbjct: 241 CAFRNARRAQTDYPHGENRMTKVKPRWDYYCWRWWYNKKEELF 283 >ref|XP_017439299.1| PREDICTED: tetraspanin-6-like [Vigna angularis] dbj|BAU01750.1| hypothetical protein VIGAN_11104800 [Vigna angularis var. angularis] Length = 283 Score = 94.4 bits (233), Expect = 2e-19 Identities = 36/43 (83%), Positives = 41/43 (95%) Frame = +3 Query: 3 CAFRNARRAESHYPHGENRMTKVKPRWDYYCWRWWHDKKEQLF 131 CAFRNARRA++ YPHG NRMTKVKPRWDYYCWRWW++KKE+LF Sbjct: 241 CAFRNARRAQTDYPHGHNRMTKVKPRWDYYCWRWWYNKKEELF 283 >ref|XP_014506970.1| tetraspanin-6 [Vigna radiata var. radiata] Length = 283 Score = 94.4 bits (233), Expect = 2e-19 Identities = 36/43 (83%), Positives = 41/43 (95%) Frame = +3 Query: 3 CAFRNARRAESHYPHGENRMTKVKPRWDYYCWRWWHDKKEQLF 131 CAFRNARRA++ YPHG NRMTKVKPRWDYYCWRWW++KKE+LF Sbjct: 241 CAFRNARRAQTDYPHGHNRMTKVKPRWDYYCWRWWYNKKEELF 283 >ref|XP_007151754.1| hypothetical protein PHAVU_004G071900g [Phaseolus vulgaris] gb|ESW23748.1| hypothetical protein PHAVU_004G071900g [Phaseolus vulgaris] Length = 283 Score = 94.4 bits (233), Expect = 2e-19 Identities = 36/43 (83%), Positives = 41/43 (95%) Frame = +3 Query: 3 CAFRNARRAESHYPHGENRMTKVKPRWDYYCWRWWHDKKEQLF 131 CAFRNARRA++ YPHG NRMTKVKPRWDYYCWRWW++KKE+LF Sbjct: 241 CAFRNARRAQTDYPHGHNRMTKVKPRWDYYCWRWWYNKKEELF 283 >ref|XP_004515993.1| PREDICTED: tetraspanin-6-like [Cicer arietinum] Length = 280 Score = 93.6 bits (231), Expect = 3e-19 Identities = 35/43 (81%), Positives = 41/43 (95%) Frame = +3 Query: 3 CAFRNARRAESHYPHGENRMTKVKPRWDYYCWRWWHDKKEQLF 131 CAFRNARR+++ Y HGENRM+KV+PRWDYYCWRWWHD+KEQLF Sbjct: 238 CAFRNARRSQTDYQHGENRMSKVRPRWDYYCWRWWHDRKEQLF 280 >ref|XP_021663989.1| tetraspanin-6-like [Hevea brasiliensis] Length = 282 Score = 93.6 bits (231), Expect = 3e-19 Identities = 36/43 (83%), Positives = 41/43 (95%) Frame = +3 Query: 3 CAFRNARRAESHYPHGENRMTKVKPRWDYYCWRWWHDKKEQLF 131 CAFRNARRAE+ YPHGENRM+KV+PRWDYY WRWWHDK+EQL+ Sbjct: 240 CAFRNARRAETDYPHGENRMSKVRPRWDYYWWRWWHDKREQLY 282 >ref|XP_003518112.1| PREDICTED: tetraspanin-6-like [Glycine max] gb|KHN00602.1| hypothetical protein glysoja_000270 [Glycine soja] gb|KRH70032.1| hypothetical protein GLYMA_02G063700 [Glycine max] Length = 283 Score = 93.6 bits (231), Expect = 3e-19 Identities = 36/43 (83%), Positives = 41/43 (95%) Frame = +3 Query: 3 CAFRNARRAESHYPHGENRMTKVKPRWDYYCWRWWHDKKEQLF 131 CAFRNARRA++ YPHG NRMTKVKPRWDYYCWRWW++KKE+LF Sbjct: 241 CAFRNARRAQTDYPHGVNRMTKVKPRWDYYCWRWWYNKKEELF 283 >ref|XP_020208472.1| tetraspanin-6-like [Cajanus cajan] gb|KYP32225.1| hypothetical protein KK1_047139 [Cajanus cajan] Length = 283 Score = 93.2 bits (230), Expect = 5e-19 Identities = 36/43 (83%), Positives = 41/43 (95%) Frame = +3 Query: 3 CAFRNARRAESHYPHGENRMTKVKPRWDYYCWRWWHDKKEQLF 131 CAFRNARRA + YPHG+NRMTKVKPRWDYYCWRWW++KKE+LF Sbjct: 241 CAFRNARRALTDYPHGQNRMTKVKPRWDYYCWRWWYNKKEELF 283 >ref|XP_019465023.1| PREDICTED: tetraspanin-6-like [Lupinus angustifolius] gb|OIV98794.1| hypothetical protein TanjilG_25040 [Lupinus angustifolius] Length = 284 Score = 90.5 bits (223), Expect = 5e-18 Identities = 35/43 (81%), Positives = 39/43 (90%) Frame = +3 Query: 3 CAFRNARRAESHYPHGENRMTKVKPRWDYYCWRWWHDKKEQLF 131 CAFRN RR+E+ Y HGENRMTK+KPRWDY+ WRWWHDKKEQLF Sbjct: 242 CAFRNTRRSETDYQHGENRMTKIKPRWDYHWWRWWHDKKEQLF 284 >gb|AFK42255.1| unknown [Medicago truncatula] Length = 283 Score = 90.1 bits (222), Expect = 6e-18 Identities = 35/43 (81%), Positives = 41/43 (95%) Frame = +3 Query: 3 CAFRNARRAESHYPHGENRMTKVKPRWDYYCWRWWHDKKEQLF 131 CAFRNARRAE+ YP+GENRMTKV+PRWDY+CWRW HD+KEQL+ Sbjct: 241 CAFRNARRAETDYPYGENRMTKVRPRWDYHCWRWLHDRKEQLY 283 >ref|XP_003591945.1| tetraspanin family protein [Medicago truncatula] gb|AES62196.1| tetraspanin family protein [Medicago truncatula] Length = 283 Score = 90.1 bits (222), Expect = 6e-18 Identities = 35/43 (81%), Positives = 41/43 (95%) Frame = +3 Query: 3 CAFRNARRAESHYPHGENRMTKVKPRWDYYCWRWWHDKKEQLF 131 CAFRNARRAE+ YP+GENRMTKV+PRWDY+CWRW HD+KEQL+ Sbjct: 241 CAFRNARRAETDYPYGENRMTKVRPRWDYHCWRWLHDRKEQLY 283 >gb|PKI74607.1| hypothetical protein CRG98_004934 [Punica granatum] Length = 283 Score = 89.7 bits (221), Expect = 9e-18 Identities = 35/43 (81%), Positives = 40/43 (93%) Frame = +3 Query: 3 CAFRNARRAESHYPHGENRMTKVKPRWDYYCWRWWHDKKEQLF 131 CAFRNARRAE++YPHGENRM+KV+PRWDYY WRWWHD KE L+ Sbjct: 241 CAFRNARRAETNYPHGENRMSKVRPRWDYYWWRWWHDFKEWLY 283 >ref|XP_021626449.1| tetraspanin-6-like [Manihot esculenta] gb|OAY38817.1| hypothetical protein MANES_10G044500 [Manihot esculenta] Length = 282 Score = 88.2 bits (217), Expect = 3e-17 Identities = 34/43 (79%), Positives = 39/43 (90%) Frame = +3 Query: 3 CAFRNARRAESHYPHGENRMTKVKPRWDYYCWRWWHDKKEQLF 131 CAF+N RRAE+ Y +GENRMTKVKPRWDYY WRWWHDK+EQL+ Sbjct: 240 CAFKNTRRAETDYAYGENRMTKVKPRWDYYWWRWWHDKREQLY 282 >ref|XP_010937833.1| PREDICTED: tetraspanin-6 [Elaeis guineensis] Length = 285 Score = 88.2 bits (217), Expect = 3e-17 Identities = 33/43 (76%), Positives = 40/43 (93%) Frame = +3 Query: 3 CAFRNARRAESHYPHGENRMTKVKPRWDYYCWRWWHDKKEQLF 131 CAFRNARRAES YP+GENRM+K++PRWDYY WRWW D++EQL+ Sbjct: 243 CAFRNARRAESEYPYGENRMSKIRPRWDYYWWRWWRDRREQLY 285 >gb|KHN00831.1| hypothetical protein glysoja_000499 [Glycine soja] Length = 283 Score = 87.4 bits (215), Expect = 6e-17 Identities = 33/43 (76%), Positives = 40/43 (93%) Frame = +3 Query: 3 CAFRNARRAESHYPHGENRMTKVKPRWDYYCWRWWHDKKEQLF 131 CAFRN RRAE+ YP+GENRMTKV+PRWDY+CWRW HD++EQL+ Sbjct: 241 CAFRNTRRAETDYPYGENRMTKVRPRWDYHCWRWLHDRREQLY 283 >ref|XP_012460703.1| PREDICTED: tetraspanin-6 [Gossypium raimondii] ref|XP_016726012.1| PREDICTED: tetraspanin-6-like [Gossypium hirsutum] gb|KJB74723.1| hypothetical protein B456_012G004000 [Gossypium raimondii] gb|PPD71924.1| hypothetical protein GOBAR_DD31181 [Gossypium barbadense] Length = 282 Score = 87.0 bits (214), Expect = 9e-17 Identities = 32/43 (74%), Positives = 40/43 (93%) Frame = +3 Query: 3 CAFRNARRAESHYPHGENRMTKVKPRWDYYCWRWWHDKKEQLF 131 CAF+N +RAE+ YP+G+NRM+KV+PRWDYY WRWWHDKKEQL+ Sbjct: 240 CAFQNTKRAETDYPYGQNRMSKVRPRWDYYWWRWWHDKKEQLY 282