BLASTX nr result
ID: Astragalus23_contig00028043
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus23_contig00028043 (474 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004498194.1| PREDICTED: pentatricopeptide repeat-containi... 62 3e-08 ref|XP_020216164.1| pentatricopeptide repeat-containing protein ... 62 5e-08 ref|XP_019420042.1| PREDICTED: pentatricopeptide repeat-containi... 61 9e-08 dbj|GAU34044.1| hypothetical protein TSUD_16320 [Trifolium subte... 60 1e-07 gb|PNX74198.1| pentatricopeptide repeat-containing protein at3g4... 60 1e-07 ref|XP_014520617.1| pentatricopeptide repeat-containing protein ... 59 4e-07 ref|XP_017427165.1| PREDICTED: pentatricopeptide repeat-containi... 59 4e-07 ref|XP_020998910.1| pentatricopeptide repeat-containing protein ... 58 8e-07 ref|XP_007153135.1| hypothetical protein PHAVU_003G009700g [Phas... 57 1e-06 ref|XP_020958392.1| pentatricopeptide repeat-containing protein ... 57 1e-06 ref|XP_021290876.1| pentatricopeptide repeat-containing protein ... 57 2e-06 ref|XP_007035867.2| PREDICTED: pentatricopeptide repeat-containi... 57 2e-06 gb|EOY06793.1| Pentatricopeptide repeat (PPR) superfamily protei... 57 2e-06 ref|XP_022741992.1| pentatricopeptide repeat-containing protein ... 56 4e-06 gb|OMO58504.1| hypothetical protein COLO4_34570 [Corchorus olito... 56 4e-06 gb|KHN01581.1| Pentatricopeptide repeat-containing protein [Glyc... 56 5e-06 ref|XP_003589699.2| PPR containing plant-like protein [Medicago ... 56 5e-06 ref|XP_003530328.1| PREDICTED: pentatricopeptide repeat-containi... 56 5e-06 ref|XP_017640529.1| PREDICTED: pentatricopeptide repeat-containi... 55 9e-06 ref|XP_016724225.1| PREDICTED: pentatricopeptide repeat-containi... 55 9e-06 >ref|XP_004498194.1| PREDICTED: pentatricopeptide repeat-containing protein At3g48810 [Cicer arietinum] Length = 662 Score = 62.4 bits (150), Expect = 3e-08 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -1 Query: 474 DIATWNVLVRSLFNNLGHMGPIRILDDILGT 382 +IATWNVLVR FNNLGHMGPIRILDDILGT Sbjct: 632 NIATWNVLVRGFFNNLGHMGPIRILDDILGT 662 >ref|XP_020216164.1| pentatricopeptide repeat-containing protein At3g48810 [Cajanus cajan] ref|XP_020216165.1| pentatricopeptide repeat-containing protein At3g48810 [Cajanus cajan] Length = 708 Score = 61.6 bits (148), Expect = 5e-08 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = -1 Query: 474 DIATWNVLVRSLFNNLGHMGPIRILDDILGTG 379 ++ATWNVLVR LFN LGHMGPIRILDDILG G Sbjct: 677 NVATWNVLVRGLFNKLGHMGPIRILDDILGNG 708 >ref|XP_019420042.1| PREDICTED: pentatricopeptide repeat-containing protein At3g48810 [Lupinus angustifolius] gb|OIV95275.1| hypothetical protein TanjilG_07431 [Lupinus angustifolius] Length = 664 Score = 60.8 bits (146), Expect = 9e-08 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = -1 Query: 474 DIATWNVLVRSLFNNLGHMGPIRILDDILGTG 379 +IATW+VLVR FNNLGHMGPIRILDDILG G Sbjct: 633 NIATWDVLVRGFFNNLGHMGPIRILDDILGNG 664 >dbj|GAU34044.1| hypothetical protein TSUD_16320 [Trifolium subterraneum] Length = 491 Score = 60.5 bits (145), Expect = 1e-07 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -1 Query: 474 DIATWNVLVRSLFNNLGHMGPIRILDDILGT 382 +IATWNVLVR F+NLGHMGPIRILDDILGT Sbjct: 460 NIATWNVLVRGFFSNLGHMGPIRILDDILGT 490 >gb|PNX74198.1| pentatricopeptide repeat-containing protein at3g48810-like protein [Trifolium pratense] Length = 663 Score = 60.5 bits (145), Expect = 1e-07 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -1 Query: 474 DIATWNVLVRSLFNNLGHMGPIRILDDILGT 382 +IATWNVLVR F+NLGHMGPIRILDDILGT Sbjct: 632 NIATWNVLVRGFFSNLGHMGPIRILDDILGT 662 >ref|XP_014520617.1| pentatricopeptide repeat-containing protein At3g48810 [Vigna radiata var. radiata] Length = 662 Score = 58.9 bits (141), Expect = 4e-07 Identities = 26/32 (81%), Positives = 27/32 (84%) Frame = -1 Query: 474 DIATWNVLVRSLFNNLGHMGPIRILDDILGTG 379 +I TWNVLVR FN LGHMGPIRILDDILG G Sbjct: 631 NIVTWNVLVRGFFNKLGHMGPIRILDDILGNG 662 >ref|XP_017427165.1| PREDICTED: pentatricopeptide repeat-containing protein At3g48810 [Vigna angularis] gb|KOM46175.1| hypothetical protein LR48_Vigan06g148100 [Vigna angularis] dbj|BAT98782.1| hypothetical protein VIGAN_10012800 [Vigna angularis var. angularis] Length = 662 Score = 58.9 bits (141), Expect = 4e-07 Identities = 26/32 (81%), Positives = 27/32 (84%) Frame = -1 Query: 474 DIATWNVLVRSLFNNLGHMGPIRILDDILGTG 379 +I TWNVLVR FN LGHMGPIRILDDILG G Sbjct: 631 NIVTWNVLVRGFFNKLGHMGPIRILDDILGNG 662 >ref|XP_020998910.1| pentatricopeptide repeat-containing protein At3g48810 [Arachis duranensis] Length = 653 Score = 58.2 bits (139), Expect = 8e-07 Identities = 24/32 (75%), Positives = 28/32 (87%) Frame = -1 Query: 474 DIATWNVLVRSLFNNLGHMGPIRILDDILGTG 379 ++ATW+VL+R FNNLGHMGP RILDDILG G Sbjct: 622 NVATWDVLIRGFFNNLGHMGPTRILDDILGNG 653 >ref|XP_007153135.1| hypothetical protein PHAVU_003G009700g [Phaseolus vulgaris] gb|ESW25129.1| hypothetical protein PHAVU_003G009700g [Phaseolus vulgaris] Length = 662 Score = 57.4 bits (137), Expect = 1e-06 Identities = 25/32 (78%), Positives = 27/32 (84%) Frame = -1 Query: 474 DIATWNVLVRSLFNNLGHMGPIRILDDILGTG 379 +I TWNVLVR FN LGH+GPIRILDDILG G Sbjct: 631 NIVTWNVLVRGFFNKLGHIGPIRILDDILGNG 662 >ref|XP_020958392.1| pentatricopeptide repeat-containing protein At3g48810-like [Arachis ipaensis] ref|XP_020958393.1| pentatricopeptide repeat-containing protein At3g48810-like [Arachis ipaensis] Length = 666 Score = 57.4 bits (137), Expect = 1e-06 Identities = 23/32 (71%), Positives = 28/32 (87%) Frame = -1 Query: 474 DIATWNVLVRSLFNNLGHMGPIRILDDILGTG 379 ++ATW+VL+R FNN+GHMGP RILDDILG G Sbjct: 635 NVATWDVLIRGFFNNMGHMGPTRILDDILGNG 666 >ref|XP_021290876.1| pentatricopeptide repeat-containing protein At3g48810 [Herrania umbratica] Length = 664 Score = 57.0 bits (136), Expect = 2e-06 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = -1 Query: 474 DIATWNVLVRSLFNNLGHMGPIRILDDILGTG 379 ++ATWNVLV+ LFN+LGH+GPI ILDDILG G Sbjct: 633 NVATWNVLVQCLFNSLGHLGPIHILDDILGNG 664 >ref|XP_007035867.2| PREDICTED: pentatricopeptide repeat-containing protein At3g48810 [Theobroma cacao] Length = 664 Score = 57.0 bits (136), Expect = 2e-06 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = -1 Query: 474 DIATWNVLVRSLFNNLGHMGPIRILDDILGTG 379 ++ATWNVLV+ LFN+LGH+GPI ILDDILG G Sbjct: 633 NVATWNVLVQCLFNSLGHLGPIHILDDILGNG 664 >gb|EOY06793.1| Pentatricopeptide repeat (PPR) superfamily protein, putative [Theobroma cacao] Length = 664 Score = 57.0 bits (136), Expect = 2e-06 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = -1 Query: 474 DIATWNVLVRSLFNNLGHMGPIRILDDILGTG 379 ++ATWNVLV+ LFN+LGH+GPI ILDDILG G Sbjct: 633 NVATWNVLVQCLFNSLGHLGPIHILDDILGNG 664 >ref|XP_022741992.1| pentatricopeptide repeat-containing protein At3g48810 [Durio zibethinus] Length = 664 Score = 56.2 bits (134), Expect = 4e-06 Identities = 23/32 (71%), Positives = 28/32 (87%) Frame = -1 Query: 474 DIATWNVLVRSLFNNLGHMGPIRILDDILGTG 379 ++ATW+VL+ LFNNLGH+GPI ILDDILG G Sbjct: 633 NVATWHVLIHCLFNNLGHLGPIHILDDILGNG 664 >gb|OMO58504.1| hypothetical protein COLO4_34570 [Corchorus olitorius] Length = 664 Score = 56.2 bits (134), Expect = 4e-06 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = -1 Query: 474 DIATWNVLVRSLFNNLGHMGPIRILDDILGTG 379 +IATWNVLV+ LFN+LGH+GP+ ILDDILG G Sbjct: 633 NIATWNVLVQCLFNSLGHLGPVHILDDILGHG 664 >gb|KHN01581.1| Pentatricopeptide repeat-containing protein [Glycine soja] Length = 489 Score = 55.8 bits (133), Expect = 5e-06 Identities = 25/32 (78%), Positives = 27/32 (84%) Frame = -1 Query: 474 DIATWNVLVRSLFNNLGHMGPIRILDDILGTG 379 +IATW+VLVR F LGHMGPIRILDDILG G Sbjct: 458 NIATWDVLVRGFFKKLGHMGPIRILDDILGKG 489 >ref|XP_003589699.2| PPR containing plant-like protein [Medicago truncatula] gb|AES59950.2| PPR containing plant-like protein [Medicago truncatula] Length = 662 Score = 55.8 bits (133), Expect = 5e-06 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = -1 Query: 474 DIATWNVLVRSLFNNLGHMGPIRILDDILGT 382 +IATWNVLVR F+ LGHMGPIRILDDI+G+ Sbjct: 629 NIATWNVLVRGFFSKLGHMGPIRILDDIIGS 659 >ref|XP_003530328.1| PREDICTED: pentatricopeptide repeat-containing protein At3g48810 [Glycine max] gb|KRH49513.1| hypothetical protein GLYMA_07G160400 [Glycine max] Length = 664 Score = 55.8 bits (133), Expect = 5e-06 Identities = 25/32 (78%), Positives = 27/32 (84%) Frame = -1 Query: 474 DIATWNVLVRSLFNNLGHMGPIRILDDILGTG 379 +IATW+VLVR F LGHMGPIRILDDILG G Sbjct: 633 NIATWDVLVRGFFKKLGHMGPIRILDDILGKG 664 >ref|XP_017640529.1| PREDICTED: pentatricopeptide repeat-containing protein At3g48810 [Gossypium arboreum] Length = 664 Score = 55.1 bits (131), Expect = 9e-06 Identities = 22/32 (68%), Positives = 29/32 (90%) Frame = -1 Query: 474 DIATWNVLVRSLFNNLGHMGPIRILDDILGTG 379 ++ATW+V V+ LFN+LGH+GPIR+LDDILG G Sbjct: 633 NVATWHVFVQCLFNSLGHLGPIRVLDDILGNG 664 >ref|XP_016724225.1| PREDICTED: pentatricopeptide repeat-containing protein At3g48810 [Gossypium hirsutum] Length = 664 Score = 55.1 bits (131), Expect = 9e-06 Identities = 22/32 (68%), Positives = 29/32 (90%) Frame = -1 Query: 474 DIATWNVLVRSLFNNLGHMGPIRILDDILGTG 379 ++ATW+V V+ LFN+LGH+GPIR+LDDILG G Sbjct: 633 NVATWHVFVQCLFNSLGHLGPIRVLDDILGNG 664