BLASTX nr result
ID: Astragalus23_contig00027541
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus23_contig00027541 (524 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PNY13148.1| pentatricopeptide repeat-containing protein at4g3... 50 1e-07 dbj|GAU26681.1| hypothetical protein TSUD_314580 [Trifolium subt... 50 1e-07 ref|XP_006578098.1| PREDICTED: pentatricopeptide repeat-containi... 50 2e-07 gb|KHN29666.1| Pentatricopeptide repeat-containing protein [Glyc... 50 2e-07 >gb|PNY13148.1| pentatricopeptide repeat-containing protein at4g33170-like protein [Trifolium pratense] Length = 1005 Score = 50.4 bits (119), Expect(2) = 1e-07 Identities = 27/40 (67%), Positives = 29/40 (72%) Frame = -2 Query: 127 VNT*AMFQCIRKARVLFDGMPVRDVVLWNVMMIRMLLCGI 8 VN A F+ IR ARVLFD MPVRDVVLWNVMM + GI Sbjct: 196 VNIYAKFRQIRDARVLFDRMPVRDVVLWNVMMKAYVEMGI 235 Score = 32.7 bits (73), Expect(2) = 1e-07 Identities = 13/17 (76%), Positives = 16/17 (94%) Frame = -1 Query: 182 VNGYALDIGLQWDVFVA 132 ++GYA+ IGLQWDVFVA Sbjct: 176 LHGYAVKIGLQWDVFVA 192 >dbj|GAU26681.1| hypothetical protein TSUD_314580 [Trifolium subterraneum] Length = 715 Score = 50.4 bits (119), Expect(2) = 1e-07 Identities = 27/40 (67%), Positives = 29/40 (72%) Frame = -2 Query: 127 VNT*AMFQCIRKARVLFDGMPVRDVVLWNVMMIRMLLCGI 8 VN A F+ IR ARVLFD MPVRDVVLWNVMM + GI Sbjct: 179 VNIYAKFRQIRDARVLFDRMPVRDVVLWNVMMKAYVEMGI 218 Score = 32.7 bits (73), Expect(2) = 1e-07 Identities = 13/17 (76%), Positives = 16/17 (94%) Frame = -1 Query: 182 VNGYALDIGLQWDVFVA 132 ++GYA+ IGLQWDVFVA Sbjct: 159 LHGYAVKIGLQWDVFVA 175 >ref|XP_006578098.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33170-like [Glycine max] gb|KRH61604.1| hypothetical protein GLYMA_04G057300 [Glycine max] Length = 980 Score = 50.1 bits (118), Expect(2) = 2e-07 Identities = 25/32 (78%), Positives = 26/32 (81%) Frame = -2 Query: 127 VNT*AMFQCIRKARVLFDGMPVRDVVLWNVMM 32 VN A F IR+ARVLFDGM VRDVVLWNVMM Sbjct: 171 VNIYAKFGLIREARVLFDGMAVRDVVLWNVMM 202 Score = 32.7 bits (73), Expect(2) = 2e-07 Identities = 13/17 (76%), Positives = 16/17 (94%) Frame = -1 Query: 182 VNGYALDIGLQWDVFVA 132 ++GYA+ IGLQWDVFVA Sbjct: 151 LHGYAVKIGLQWDVFVA 167 >gb|KHN29666.1| Pentatricopeptide repeat-containing protein [Glycine soja] Length = 843 Score = 50.1 bits (118), Expect(2) = 2e-07 Identities = 25/32 (78%), Positives = 26/32 (81%) Frame = -2 Query: 127 VNT*AMFQCIRKARVLFDGMPVRDVVLWNVMM 32 VN A F IR+ARVLFDGM VRDVVLWNVMM Sbjct: 34 VNIYAKFGLIREARVLFDGMAVRDVVLWNVMM 65 Score = 32.7 bits (73), Expect(2) = 2e-07 Identities = 13/17 (76%), Positives = 16/17 (94%) Frame = -1 Query: 182 VNGYALDIGLQWDVFVA 132 ++GYA+ IGLQWDVFVA Sbjct: 14 LHGYAVKIGLQWDVFVA 30