BLASTX nr result
ID: Astragalus23_contig00027373
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus23_contig00027373 (378 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004486073.1| PREDICTED: uncharacterized protein LOC101501... 62 1e-08 dbj|GAU37719.1| hypothetical protein TSUD_382120 [Trifolium subt... 59 3e-08 dbj|GAU37718.1| hypothetical protein TSUD_382110 [Trifolium subt... 59 2e-07 ref|XP_007147853.1| hypothetical protein PHAVU_006G160300g [Phas... 56 2e-06 >ref|XP_004486073.1| PREDICTED: uncharacterized protein LOC101501524 [Cicer arietinum] Length = 1139 Score = 62.4 bits (150), Expect = 1e-08 Identities = 33/59 (55%), Positives = 40/59 (67%), Gaps = 3/59 (5%) Frame = -1 Query: 186 MGKNGDDR---SKTSIAADFRYIDTEPFDDTSSPSSGEEDVYGDNECRYFEDTVPFDDD 19 M KN D S TS+ +DF + DT+PFDD SSG++D D+ECRYFEDTVP DDD Sbjct: 1 MAKNEDHHRIHSNTSLNSDFNHFDTQPFDD----SSGDDD--DDDECRYFEDTVPLDDD 53 >dbj|GAU37719.1| hypothetical protein TSUD_382120 [Trifolium subterraneum] Length = 136 Score = 58.5 bits (140), Expect = 3e-08 Identities = 26/44 (59%), Positives = 34/44 (77%) Frame = -1 Query: 141 DFRYIDTEPFDDTSSPSSGEEDVYGDNECRYFEDTVPFDDDIDV 10 DF + DT+PFD +SSP S ++DV D E RYFEDTVPFDD+ ++ Sbjct: 9 DFNHCDTQPFD-SSSPHSSDDDVDDDKENRYFEDTVPFDDEFEI 51 >dbj|GAU37718.1| hypothetical protein TSUD_382110 [Trifolium subterraneum] Length = 1137 Score = 58.5 bits (140), Expect = 2e-07 Identities = 26/44 (59%), Positives = 34/44 (77%) Frame = -1 Query: 141 DFRYIDTEPFDDTSSPSSGEEDVYGDNECRYFEDTVPFDDDIDV 10 DF + DT+PFD +SSP S ++DV D E RYFEDTVPFDD+ ++ Sbjct: 9 DFNHCDTQPFD-SSSPHSSDDDVDDDKENRYFEDTVPFDDEFEI 51 >ref|XP_007147853.1| hypothetical protein PHAVU_006G160300g [Phaseolus vulgaris] gb|ESW19847.1| hypothetical protein PHAVU_006G160300g [Phaseolus vulgaris] Length = 1124 Score = 55.8 bits (133), Expect = 2e-06 Identities = 30/51 (58%), Positives = 33/51 (64%) Frame = -1 Query: 171 DDRSKTSIAADFRYIDTEPFDDTSSPSSGEEDVYGDNECRYFEDTVPFDDD 19 DDR I ADF Y+DT+PFD E+D DNE RYFEDTVPFDDD Sbjct: 10 DDRG---IHADFDYVDTQPFD----ADGVEDDDCDDNEWRYFEDTVPFDDD 53