BLASTX nr result
ID: Astragalus23_contig00027208
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus23_contig00027208 (370 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GAU48590.1| hypothetical protein TSUD_405800 [Trifolium subt... 44 2e-08 >dbj|GAU48590.1| hypothetical protein TSUD_405800 [Trifolium subterraneum] Length = 818 Score = 43.5 bits (101), Expect(2) = 2e-08 Identities = 21/60 (35%), Positives = 29/60 (48%), Gaps = 11/60 (18%) Frame = +1 Query: 22 HIPLGHFSKLLVHITPKATDSSDLTFWPGNHSREFSVEE-----------VNNQIWKKVW 168 ++P K+L+ I P+ATD +D+ WPGN FSV V Q W +VW Sbjct: 496 YLPQEILDKILILIPPRATDGADVRVWPGNRMGMFSVSSAYKLLRGYHLLVQEQCWSRVW 555 Score = 42.4 bits (98), Expect(2) = 2e-08 Identities = 20/43 (46%), Positives = 22/43 (51%) Frame = +3 Query: 165 VEKISAPERVRTFAWQNLHGKLATKLHCSKWSSANLTYHNCSG 293 V + PERVR F W +HG L T CSKW S H C G Sbjct: 554 VWSLDVPERVRCFIWLLIHGLLPTNKLCSKWGSRVSDCHLCIG 596