BLASTX nr result
ID: Astragalus23_contig00027193
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus23_contig00027193 (179 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KYP73902.1| Putative pentatricopeptide repeat-containing prot... 80 6e-16 ref|XP_020210320.1| pentatricopeptide repeat-containing protein ... 80 6e-16 ref|XP_013467967.1| organelle transcript processing protein, put... 77 6e-15 gb|PNY14599.1| pentatricopeptide repeat-containing protein at1g0... 76 1e-14 gb|KHN42800.1| Pentatricopeptide repeat-containing protein, chlo... 75 3e-14 ref|XP_004515218.1| PREDICTED: pentatricopeptide repeat-containi... 75 3e-14 ref|XP_004515217.1| PREDICTED: pentatricopeptide repeat-containi... 75 3e-14 ref|XP_006575303.1| PREDICTED: pentatricopeptide repeat-containi... 75 3e-14 dbj|GAU49058.1| hypothetical protein TSUD_25160 [Trifolium subte... 72 2e-13 ref|XP_015951604.1| pentatricopeptide repeat-containing protein ... 70 2e-12 ref|XP_016186724.1| pentatricopeptide repeat-containing protein ... 70 2e-12 ref|XP_019426833.1| PREDICTED: pentatricopeptide repeat-containi... 69 3e-12 gb|OIV90388.1| hypothetical protein TanjilG_10688 [Lupinus angus... 69 3e-12 ref|XP_021622093.1| pentatricopeptide repeat-containing protein ... 67 1e-11 gb|OAY40844.1| hypothetical protein MANES_09G053600 [Manihot esc... 67 1e-11 ref|XP_010654106.1| PREDICTED: pentatricopeptide repeat-containi... 67 2e-11 ref|XP_010654107.1| PREDICTED: pentatricopeptide repeat-containi... 67 2e-11 emb|CAN68552.1| hypothetical protein VITISV_014227 [Vitis vinifera] 67 2e-11 gb|EEF32051.1| Bipolar kinesin KRP-130, putative [Ricinus communis] 67 2e-11 ref|XP_015898615.1| PREDICTED: beta-fructofuranosidase, insolubl... 65 1e-10 >gb|KYP73902.1| Putative pentatricopeptide repeat-containing protein At3g23330 family [Cajanus cajan] Length = 511 Score = 79.7 bits (195), Expect = 6e-16 Identities = 44/65 (67%), Positives = 46/65 (70%), Gaps = 6/65 (9%) Frame = -2 Query: 178 YATFREVLRCGVTPGNNTLPF------DYKNLQGSFCYTCVVLKYGLLLDHFVCASFVDM 17 YATFREVLRCGVTP N TLPF D K+LQ VVLK+GL LDHFVCAS VDM Sbjct: 24 YATFREVLRCGVTPDNYTLPFVIRTSRDTKDLQMGRVIHDVVLKHGLHLDHFVCASLVDM 83 Query: 16 YAKFM 2 YAK M Sbjct: 84 YAKCM 88 >ref|XP_020210320.1| pentatricopeptide repeat-containing protein At1g08070, chloroplastic-like [Cajanus cajan] Length = 573 Score = 79.7 bits (195), Expect = 6e-16 Identities = 44/65 (67%), Positives = 46/65 (70%), Gaps = 6/65 (9%) Frame = -2 Query: 178 YATFREVLRCGVTPGNNTLPF------DYKNLQGSFCYTCVVLKYGLLLDHFVCASFVDM 17 YATFREVLRCGVTP N TLPF D K+LQ VVLK+GL LDHFVCAS VDM Sbjct: 86 YATFREVLRCGVTPDNYTLPFVIRTSRDTKDLQMGRVIHDVVLKHGLHLDHFVCASLVDM 145 Query: 16 YAKFM 2 YAK M Sbjct: 146 YAKCM 150 >ref|XP_013467967.1| organelle transcript processing protein, putative [Medicago truncatula] gb|KEH42004.1| organelle transcript processing protein, putative [Medicago truncatula] Length = 574 Score = 77.0 bits (188), Expect = 6e-15 Identities = 39/63 (61%), Positives = 45/63 (71%), Gaps = 6/63 (9%) Frame = -2 Query: 178 YATFREVLRCGVTPGNNTLPF------DYKNLQGSFCYTCVVLKYGLLLDHFVCASFVDM 17 YATFRE+LRC +TP N TLPF D K++Q VVLKYGL+LDHFVCA+ VDM Sbjct: 86 YATFREILRCNITPDNYTLPFVIRACRDRKDIQMGRMIHDVVLKYGLVLDHFVCATLVDM 145 Query: 16 YAK 8 YAK Sbjct: 146 YAK 148 >gb|PNY14599.1| pentatricopeptide repeat-containing protein at1g08070-like protein [Trifolium pratense] Length = 573 Score = 76.3 bits (186), Expect = 1e-14 Identities = 40/65 (61%), Positives = 45/65 (69%), Gaps = 6/65 (9%) Frame = -2 Query: 178 YATFREVLRCGVTPGNNTLPF------DYKNLQGSFCYTCVVLKYGLLLDHFVCASFVDM 17 YATFRE++RCGVTP N TLPF D K+ Q VVLK+GL LDHFVCA+ VDM Sbjct: 86 YATFREIIRCGVTPDNYTLPFVIRTCRDRKDFQMGQMIHNVVLKHGLQLDHFVCATLVDM 145 Query: 16 YAKFM 2 YAK M Sbjct: 146 YAKCM 150 >gb|KHN42800.1| Pentatricopeptide repeat-containing protein, chloroplastic [Glycine soja] Length = 573 Score = 75.1 bits (183), Expect = 3e-14 Identities = 41/63 (65%), Positives = 44/63 (69%), Gaps = 6/63 (9%) Frame = -2 Query: 178 YATFREVLRCGVTPGNNTLPF------DYKNLQGSFCYTCVVLKYGLLLDHFVCASFVDM 17 YATFRE+LRCGVTP N TLPF D +LQ VVLK+GLL DHFVCAS VDM Sbjct: 86 YATFRELLRCGVTPDNYTLPFVIRTCRDRTDLQIGRVIHDVVLKHGLLSDHFVCASLVDM 145 Query: 16 YAK 8 YAK Sbjct: 146 YAK 148 >ref|XP_004515218.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Cicer arietinum] Length = 573 Score = 75.1 bits (183), Expect = 3e-14 Identities = 41/65 (63%), Positives = 45/65 (69%), Gaps = 6/65 (9%) Frame = -2 Query: 178 YATFREVLRCGVTPGNNTLPF------DYKNLQGSFCYTCVVLKYGLLLDHFVCASFVDM 17 YATFRE+LR GVTP N TLPF D K+ Q VVLK+GLLLDHFVCA+ VDM Sbjct: 86 YATFREILRYGVTPDNYTLPFVIRTCRDRKDFQMGQMIHDVVLKHGLLLDHFVCATLVDM 145 Query: 16 YAKFM 2 YAK M Sbjct: 146 YAKCM 150 >ref|XP_004515217.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial-like [Cicer arietinum] Length = 573 Score = 75.1 bits (183), Expect = 3e-14 Identities = 41/65 (63%), Positives = 45/65 (69%), Gaps = 6/65 (9%) Frame = -2 Query: 178 YATFREVLRCGVTPGNNTLPF------DYKNLQGSFCYTCVVLKYGLLLDHFVCASFVDM 17 YATFRE+LR GVTP N TLPF D K+ Q VVLK+GLLLDHFVCA+ VDM Sbjct: 86 YATFREILRYGVTPDNYTLPFVIRTCRDRKDFQMGQMIHDVVLKHGLLLDHFVCATLVDM 145 Query: 16 YAKFM 2 YAK M Sbjct: 146 YAKCM 150 >ref|XP_006575303.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070, chloroplastic-like [Glycine max] gb|KRH72271.1| hypothetical protein GLYMA_02G201800 [Glycine max] Length = 573 Score = 75.1 bits (183), Expect = 3e-14 Identities = 41/63 (65%), Positives = 44/63 (69%), Gaps = 6/63 (9%) Frame = -2 Query: 178 YATFREVLRCGVTPGNNTLPF------DYKNLQGSFCYTCVVLKYGLLLDHFVCASFVDM 17 YATFRE+LRCGVTP N TLPF D +LQ VVLK+GLL DHFVCAS VDM Sbjct: 86 YATFRELLRCGVTPDNYTLPFVIRTCRDRTDLQIGRVIHDVVLKHGLLSDHFVCASLVDM 145 Query: 16 YAK 8 YAK Sbjct: 146 YAK 148 >dbj|GAU49058.1| hypothetical protein TSUD_25160 [Trifolium subterraneum] Length = 573 Score = 72.4 bits (176), Expect = 2e-13 Identities = 40/65 (61%), Positives = 44/65 (67%), Gaps = 6/65 (9%) Frame = -2 Query: 178 YATFREVLRCGVTPGNNTLPF------DYKNLQGSFCYTCVVLKYGLLLDHFVCASFVDM 17 YATFRE+LR GVTP N TLPF D K+ Q VVLK+GL LDHFVCA+ VDM Sbjct: 86 YATFREILRNGVTPDNYTLPFVIRTCRDRKDFQMGQIIHDVVLKHGLQLDHFVCATLVDM 145 Query: 16 YAKFM 2 YAK M Sbjct: 146 YAKCM 150 >ref|XP_015951604.1| pentatricopeptide repeat-containing protein At2g33760-like [Arachis duranensis] Length = 554 Score = 70.1 bits (170), Expect = 2e-12 Identities = 39/63 (61%), Positives = 42/63 (66%), Gaps = 6/63 (9%) Frame = -2 Query: 178 YATFREVLRCGVTPGNNTLPF------DYKNLQGSFCYTCVVLKYGLLLDHFVCASFVDM 17 YATFRE+LR GVTP N TLP D K+L+ CVVLK GL LDHFVCAS VDM Sbjct: 86 YATFREILRRGVTPDNYTLPCLVRICRDRKDLRMGRVIHCVVLKDGLHLDHFVCASLVDM 145 Query: 16 YAK 8 Y K Sbjct: 146 YTK 148 >ref|XP_016186724.1| pentatricopeptide repeat-containing protein At2g33760-like [Arachis ipaensis] Length = 573 Score = 70.1 bits (170), Expect = 2e-12 Identities = 39/63 (61%), Positives = 42/63 (66%), Gaps = 6/63 (9%) Frame = -2 Query: 178 YATFREVLRCGVTPGNNTLPF------DYKNLQGSFCYTCVVLKYGLLLDHFVCASFVDM 17 YATFRE+LR GVTP N TLP D K+L+ CVVLK GL LDHFVCAS VDM Sbjct: 86 YATFREILRRGVTPDNYTLPCLVRICRDRKDLRMGRVIHCVVLKDGLHLDHFVCASLVDM 145 Query: 16 YAK 8 Y K Sbjct: 146 YTK 148 >ref|XP_019426833.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070, chloroplastic-like [Lupinus angustifolius] Length = 573 Score = 69.3 bits (168), Expect = 3e-12 Identities = 39/63 (61%), Positives = 42/63 (66%), Gaps = 6/63 (9%) Frame = -2 Query: 178 YATFREVLRCGVTPGNNTLPF------DYKNLQGSFCYTCVVLKYGLLLDHFVCASFVDM 17 YATFREVLR V P N TLPF D K+L+ VVLK+GLL DHFVCAS VDM Sbjct: 86 YATFREVLRSDVAPDNYTLPFVIRTCRDGKDLRMGHVIHDVVLKHGLLSDHFVCASLVDM 145 Query: 16 YAK 8 YAK Sbjct: 146 YAK 148 >gb|OIV90388.1| hypothetical protein TanjilG_10688 [Lupinus angustifolius] Length = 1543 Score = 69.3 bits (168), Expect = 3e-12 Identities = 39/63 (61%), Positives = 42/63 (66%), Gaps = 6/63 (9%) Frame = -2 Query: 178 YATFREVLRCGVTPGNNTLPF------DYKNLQGSFCYTCVVLKYGLLLDHFVCASFVDM 17 YATFREVLR V P N TLPF D K+L+ VVLK+GLL DHFVCAS VDM Sbjct: 1056 YATFREVLRSDVAPDNYTLPFVIRTCRDGKDLRMGHVIHDVVLKHGLLSDHFVCASLVDM 1115 Query: 16 YAK 8 YAK Sbjct: 1116 YAK 1118 >ref|XP_021622093.1| pentatricopeptide repeat-containing protein At2g33760-like [Manihot esculenta] Length = 669 Score = 67.4 bits (163), Expect = 1e-11 Identities = 33/61 (54%), Positives = 41/61 (67%), Gaps = 6/61 (9%) Frame = -2 Query: 172 TFREVLRCGVTPGNNTLPF------DYKNLQGSFCYTCVVLKYGLLLDHFVCASFVDMYA 11 TFRE++RCG+ P N +LPF D + L+ C+V KYGL LDHFVCA+ VDMYA Sbjct: 183 TFRELIRCGMQPDNYSLPFVIKACRDTRGLEIGTSVHCIVKKYGLHLDHFVCAALVDMYA 242 Query: 10 K 8 K Sbjct: 243 K 243 >gb|OAY40844.1| hypothetical protein MANES_09G053600 [Manihot esculenta] Length = 1617 Score = 67.4 bits (163), Expect = 1e-11 Identities = 33/61 (54%), Positives = 41/61 (67%), Gaps = 6/61 (9%) Frame = -2 Query: 172 TFREVLRCGVTPGNNTLPF------DYKNLQGSFCYTCVVLKYGLLLDHFVCASFVDMYA 11 TFRE++RCG+ P N +LPF D + L+ C+V KYGL LDHFVCA+ VDMYA Sbjct: 1146 TFRELIRCGMQPDNYSLPFVIKACRDTRGLEIGTSVHCIVKKYGLHLDHFVCAALVDMYA 1205 Query: 10 K 8 K Sbjct: 1206 K 1206 >ref|XP_010654106.1| PREDICTED: pentatricopeptide repeat-containing protein At2g33760-like [Vitis vinifera] ref|XP_019077138.1| PREDICTED: pentatricopeptide repeat-containing protein At2g33760-like [Vitis vinifera] Length = 633 Score = 67.0 bits (162), Expect = 2e-11 Identities = 34/63 (53%), Positives = 40/63 (63%), Gaps = 6/63 (9%) Frame = -2 Query: 178 YATFREVLRCGVTPGNNTLPF------DYKNLQGSFCYTCVVLKYGLLLDHFVCASFVDM 17 + TFRE++RCG P N TLPF D KNLQ +V K+GL LDHFVCA+ VDM Sbjct: 145 FGTFRELIRCGARPDNYTLPFVIRACRDLKNLQMGRLIHHIVYKFGLDLDHFVCAALVDM 204 Query: 16 YAK 8 Y K Sbjct: 205 YGK 207 >ref|XP_010654107.1| PREDICTED: pentatricopeptide repeat-containing protein At2g33760-like [Vitis vinifera] ref|XP_010654108.1| PREDICTED: pentatricopeptide repeat-containing protein At2g33760-like [Vitis vinifera] Length = 633 Score = 67.0 bits (162), Expect = 2e-11 Identities = 34/63 (53%), Positives = 40/63 (63%), Gaps = 6/63 (9%) Frame = -2 Query: 178 YATFREVLRCGVTPGNNTLPF------DYKNLQGSFCYTCVVLKYGLLLDHFVCASFVDM 17 + TFRE++RCG P N TLPF D KNLQ +V K+GL LDHFVCA+ VDM Sbjct: 145 FGTFRELIRCGARPDNYTLPFVIRACRDLKNLQMGRLIHHIVYKFGLDLDHFVCAALVDM 204 Query: 16 YAK 8 Y K Sbjct: 205 YVK 207 >emb|CAN68552.1| hypothetical protein VITISV_014227 [Vitis vinifera] Length = 1309 Score = 67.0 bits (162), Expect = 2e-11 Identities = 34/63 (53%), Positives = 40/63 (63%), Gaps = 6/63 (9%) Frame = -2 Query: 178 YATFREVLRCGVTPGNNTLPF------DYKNLQGSFCYTCVVLKYGLLLDHFVCASFVDM 17 + TFRE++RCG P N TLPF D KNLQ +V K+GL LDHFVCA+ VDM Sbjct: 145 FGTFRELIRCGARPDNYTLPFVIRACRDLKNLQMGRLIHHIVYKFGLDLDHFVCAALVDM 204 Query: 16 YAK 8 Y K Sbjct: 205 YVK 207 Score = 67.0 bits (162), Expect = 2e-11 Identities = 34/63 (53%), Positives = 40/63 (63%), Gaps = 6/63 (9%) Frame = -2 Query: 178 YATFREVLRCGVTPGNNTLPF------DYKNLQGSFCYTCVVLKYGLLLDHFVCASFVDM 17 + TFRE++RCG P N TLPF D KNLQ +V K+GL LDHFVCA+ VDM Sbjct: 821 FGTFRELIRCGARPDNYTLPFVIRACRDLKNLQMGRLIHHIVYKFGLDLDHFVCAALVDM 880 Query: 16 YAK 8 Y K Sbjct: 881 YGK 883 >gb|EEF32051.1| Bipolar kinesin KRP-130, putative [Ricinus communis] Length = 1530 Score = 67.0 bits (162), Expect = 2e-11 Identities = 35/63 (55%), Positives = 41/63 (65%), Gaps = 6/63 (9%) Frame = -2 Query: 178 YATFREVLRCGVTPGNNTLPFDYKNLQGSFCYT------CVVLKYGLLLDHFVCASFVDM 17 Y TF+E++R GV P N TLPF K + + CVVLKYGL LDHFVCA+ VDM Sbjct: 1166 YKTFKELIRNGVQPDNYTLPFVIKACRDTVALDMGRLIHCVVLKYGLHLDHFVCAALVDM 1225 Query: 16 YAK 8 YAK Sbjct: 1226 YAK 1228 >ref|XP_015898615.1| PREDICTED: beta-fructofuranosidase, insoluble isoenzyme 3-like [Ziziphus jujuba] Length = 571 Score = 64.7 bits (156), Expect = 1e-10 Identities = 34/63 (53%), Positives = 40/63 (63%), Gaps = 6/63 (9%) Frame = -2 Query: 178 YATFREVLRCGVTPGNNTLPF------DYKNLQGSFCYTCVVLKYGLLLDHFVCASFVDM 17 + FRE++RCGVTP N TLPF D +L VVLK+GL DHFVCA+ VDM Sbjct: 145 FGIFRELIRCGVTPDNYTLPFVIRACRDMTDLVTGKLIHAVVLKHGLHSDHFVCAALVDM 204 Query: 16 YAK 8 YAK Sbjct: 205 YAK 207