BLASTX nr result
ID: Astragalus23_contig00026983
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus23_contig00026983 (293 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_019455969.1| PREDICTED: heat shock 70 kDa protein 16 isof... 54 5e-06 ref|XP_019455968.1| PREDICTED: heat shock 70 kDa protein 16 isof... 54 5e-06 ref|XP_019455967.1| PREDICTED: heat shock 70 kDa protein 16 isof... 54 5e-06 gb|OIW04223.1| hypothetical protein TanjilG_00783 [Lupinus angus... 54 5e-06 >ref|XP_019455969.1| PREDICTED: heat shock 70 kDa protein 16 isoform X3 [Lupinus angustifolius] Length = 719 Score = 53.5 bits (127), Expect = 5e-06 Identities = 26/38 (68%), Positives = 31/38 (81%), Gaps = 1/38 (2%) Frame = -3 Query: 228 KERIGISIRLQDIEEWIYDDGDDETVHAYSA-TTDLKR 118 KER GIS LQ+ EEW+YDDG+DET+HAYSA DLK+ Sbjct: 571 KERDGISRGLQETEEWLYDDGEDETLHAYSAKLEDLKQ 608 >ref|XP_019455968.1| PREDICTED: heat shock 70 kDa protein 16 isoform X2 [Lupinus angustifolius] Length = 760 Score = 53.5 bits (127), Expect = 5e-06 Identities = 26/38 (68%), Positives = 31/38 (81%), Gaps = 1/38 (2%) Frame = -3 Query: 228 KERIGISIRLQDIEEWIYDDGDDETVHAYSA-TTDLKR 118 KER GIS LQ+ EEW+YDDG+DET+HAYSA DLK+ Sbjct: 612 KERDGISRGLQETEEWLYDDGEDETLHAYSAKLEDLKQ 649 >ref|XP_019455967.1| PREDICTED: heat shock 70 kDa protein 16 isoform X1 [Lupinus angustifolius] Length = 768 Score = 53.5 bits (127), Expect = 5e-06 Identities = 26/38 (68%), Positives = 31/38 (81%), Gaps = 1/38 (2%) Frame = -3 Query: 228 KERIGISIRLQDIEEWIYDDGDDETVHAYSA-TTDLKR 118 KER GIS LQ+ EEW+YDDG+DET+HAYSA DLK+ Sbjct: 620 KERDGISRGLQETEEWLYDDGEDETLHAYSAKLEDLKQ 657 >gb|OIW04223.1| hypothetical protein TanjilG_00783 [Lupinus angustifolius] Length = 821 Score = 53.5 bits (127), Expect = 5e-06 Identities = 26/38 (68%), Positives = 31/38 (81%), Gaps = 1/38 (2%) Frame = -3 Query: 228 KERIGISIRLQDIEEWIYDDGDDETVHAYSA-TTDLKR 118 KER GIS LQ+ EEW+YDDG+DET+HAYSA DLK+ Sbjct: 620 KERDGISRGLQETEEWLYDDGEDETLHAYSAKLEDLKQ 657