BLASTX nr result
ID: Astragalus23_contig00026931
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus23_contig00026931 (817 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PNX90148.1| hypothetical protein L195_g046271, partial [Trifo... 65 1e-12 >gb|PNX90148.1| hypothetical protein L195_g046271, partial [Trifolium pratense] Length = 263 Score = 64.7 bits (156), Expect(2) = 1e-12 Identities = 35/95 (36%), Positives = 56/95 (58%) Frame = +2 Query: 122 RMEEISVDIARLLK*MDVVRPESNTLTTKLNSFADHRDHLYTRCSSLDHEMVVLLSQKIG 301 R ++ + + + M ++ ES L ++L +F+D R +LY +SLDH++V LLSQK+G Sbjct: 153 RTASLNTQLEAIRQEMTNLKTESTQLASQLATFSDQRLNLYAEATSLDHDIVPLLSQKVG 212 Query: 302 IERDLAKGQDDLVEANRA*DQLCHLLVGARKPVAM 406 +E D G + L E N+ D L +LV A P A+ Sbjct: 213 LEIDFKIGGEGLAEFNKTWDCLRQMLVQATNPEAL 247 Score = 37.0 bits (84), Expect(2) = 1e-12 Identities = 22/42 (52%), Positives = 28/42 (66%), Gaps = 1/42 (2%) Frame = +1 Query: 1 ASHSLKRLRDLHDKKSHF*STF-ALEAERKEALSRHKVINKK 123 AS LKRL +L +KKS F S++ ALE ERK L+R K I + Sbjct: 112 ASLHLKRLGELQEKKSKFQSSYLALETERKSILTRQKEIEDR 153