BLASTX nr result
ID: Astragalus23_contig00026718
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus23_contig00026718 (308 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012082824.1| ethylene response sensor 1 [Jatropha curcas]... 59 5e-08 gb|OMO63888.1| hypothetical protein CCACVL1_22194 [Corchorus cap... 58 2e-07 ref|XP_023513639.1| ethylene response sensor 1-like isoform X2 [... 57 2e-07 ref|XP_023004489.1| probable ethylene response sensor 1 isoform ... 57 2e-07 ref|XP_022959745.1| ethylene response sensor 1-like [Cucurbita m... 57 2e-07 ref|XP_010038248.1| PREDICTED: ethylene response sensor 1 [Eucal... 57 2e-07 ref|XP_023548975.1| probable ethylene response sensor 1 [Cucurbi... 57 2e-07 ref|XP_022991222.1| probable ethylene response sensor 1 [Cucurbi... 57 2e-07 ref|XP_022953704.1| probable ethylene response sensor 1 [Cucurbi... 57 2e-07 gb|EEF39314.1| ethylene receptor, putative [Ricinus communis] 57 2e-07 gb|AGD95025.1| ethylene receptor 1 [Cucurbita pepo] 57 2e-07 ref|XP_022147113.1| probable ethylene response sensor 1 isoform ... 57 2e-07 ref|XP_002523129.2| PREDICTED: ethylene response sensor 1 [Ricin... 57 2e-07 ref|XP_023513638.1| ethylene response sensor 1-like isoform X1 [... 57 2e-07 ref|XP_023004490.1| ethylene response sensor 1-like isoform X2 [... 57 2e-07 ref|XP_022147103.1| probable ethylene response sensor 1 isoform ... 57 2e-07 gb|KJB49871.1| hypothetical protein B456_008G143100 [Gossypium r... 57 4e-07 gb|PNT50723.1| hypothetical protein POPTR_002G201500v3 [Populus ... 57 4e-07 gb|PNT50721.1| hypothetical protein POPTR_002G201500v3 [Populus ... 57 5e-07 gb|PNT50724.1| hypothetical protein POPTR_002G201500v3 [Populus ... 57 5e-07 >ref|XP_012082824.1| ethylene response sensor 1 [Jatropha curcas] gb|KDP28202.1| hypothetical protein JCGZ_13973 [Jatropha curcas] Length = 638 Score = 59.3 bits (142), Expect = 5e-08 Identities = 31/52 (59%), Positives = 40/52 (76%), Gaps = 1/52 (1%) Frame = -3 Query: 273 IHNIIDMLSGNTCELLLMNKVEEFAK-MTLVLTQEETGQHVRMLPHDMKNSL 121 +H I D+LS T ELLL NK EE K M L+LTQEETG+HVRML H+++++L Sbjct: 106 VHIIPDLLSVKTRELLLKNKAEELDKEMGLILTQEETGRHVRMLTHEIRSTL 157 >gb|OMO63888.1| hypothetical protein CCACVL1_22194 [Corchorus capsularis] Length = 634 Score = 57.8 bits (138), Expect = 2e-07 Identities = 29/52 (55%), Positives = 40/52 (76%), Gaps = 1/52 (1%) Frame = -3 Query: 273 IHNIIDMLSGNTCELLLMNKVEEFAK-MTLVLTQEETGQHVRMLPHDMKNSL 121 +H I D+LS T EL L NK EE + M+L+LTQEETG+HVRML H+++++L Sbjct: 106 VHIIPDLLSVKTRELFLRNKAEELDREMSLILTQEETGRHVRMLTHEIRSTL 157 >ref|XP_023513639.1| ethylene response sensor 1-like isoform X2 [Cucurbita pepo subsp. pepo] Length = 633 Score = 57.4 bits (137), Expect = 2e-07 Identities = 29/52 (55%), Positives = 40/52 (76%), Gaps = 1/52 (1%) Frame = -3 Query: 273 IHNIIDMLSGNTCELLLMNKVEEFAK-MTLVLTQEETGQHVRMLPHDMKNSL 121 +H I D+LS T EL+L NK EE + M L+LTQEETG+HVRML H+++++L Sbjct: 107 VHIIPDLLSVKTRELILKNKAEELDREMGLILTQEETGRHVRMLTHEIRSTL 158 >ref|XP_023004489.1| probable ethylene response sensor 1 isoform X1 [Cucurbita maxima] Length = 633 Score = 57.4 bits (137), Expect = 2e-07 Identities = 29/52 (55%), Positives = 40/52 (76%), Gaps = 1/52 (1%) Frame = -3 Query: 273 IHNIIDMLSGNTCELLLMNKVEEFAK-MTLVLTQEETGQHVRMLPHDMKNSL 121 +H I D+LS T EL+L NK EE + M L+LTQEETG+HVRML H+++++L Sbjct: 107 VHIIPDLLSVKTRELILKNKAEELDREMGLILTQEETGRHVRMLTHEIRSTL 158 >ref|XP_022959745.1| ethylene response sensor 1-like [Cucurbita moschata] ref|XP_022959746.1| ethylene response sensor 1-like [Cucurbita moschata] Length = 633 Score = 57.4 bits (137), Expect = 2e-07 Identities = 29/52 (55%), Positives = 40/52 (76%), Gaps = 1/52 (1%) Frame = -3 Query: 273 IHNIIDMLSGNTCELLLMNKVEEFAK-MTLVLTQEETGQHVRMLPHDMKNSL 121 +H I D+LS T EL+L NK EE + M L+LTQEETG+HVRML H+++++L Sbjct: 107 VHIIPDLLSVKTRELILKNKAEELDREMGLILTQEETGRHVRMLTHEIRSTL 158 >ref|XP_010038248.1| PREDICTED: ethylene response sensor 1 [Eucalyptus grandis] ref|XP_010038250.1| PREDICTED: ethylene response sensor 1 [Eucalyptus grandis] ref|XP_018721023.1| PREDICTED: ethylene response sensor 1 [Eucalyptus grandis] gb|KCW50074.1| hypothetical protein EUGRSUZ_K03513 [Eucalyptus grandis] Length = 635 Score = 57.4 bits (137), Expect = 2e-07 Identities = 29/52 (55%), Positives = 40/52 (76%), Gaps = 1/52 (1%) Frame = -3 Query: 273 IHNIIDMLSGNTCELLLMNKVEEFAK-MTLVLTQEETGQHVRMLPHDMKNSL 121 +H I D+LS T EL+L NK EE + M L+LTQEETG+HVRML H+++++L Sbjct: 107 VHIIPDLLSVKTRELILKNKAEELDREMGLILTQEETGRHVRMLTHEIRSTL 158 >ref|XP_023548975.1| probable ethylene response sensor 1 [Cucurbita pepo subsp. pepo] Length = 636 Score = 57.4 bits (137), Expect = 2e-07 Identities = 29/52 (55%), Positives = 40/52 (76%), Gaps = 1/52 (1%) Frame = -3 Query: 273 IHNIIDMLSGNTCELLLMNKVEEFAK-MTLVLTQEETGQHVRMLPHDMKNSL 121 +H I D+LS T EL+L NK EE + M L+LTQEETG+HVRML H+++++L Sbjct: 106 VHIIPDLLSVKTRELILKNKAEELDREMGLILTQEETGRHVRMLTHEIRSTL 157 >ref|XP_022991222.1| probable ethylene response sensor 1 [Cucurbita maxima] Length = 636 Score = 57.4 bits (137), Expect = 2e-07 Identities = 29/52 (55%), Positives = 40/52 (76%), Gaps = 1/52 (1%) Frame = -3 Query: 273 IHNIIDMLSGNTCELLLMNKVEEFAK-MTLVLTQEETGQHVRMLPHDMKNSL 121 +H I D+LS T EL+L NK EE + M L+LTQEETG+HVRML H+++++L Sbjct: 106 VHIIPDLLSVKTRELILKNKAEELDREMGLILTQEETGRHVRMLTHEIRSTL 157 >ref|XP_022953704.1| probable ethylene response sensor 1 [Cucurbita moschata] Length = 636 Score = 57.4 bits (137), Expect = 2e-07 Identities = 29/52 (55%), Positives = 40/52 (76%), Gaps = 1/52 (1%) Frame = -3 Query: 273 IHNIIDMLSGNTCELLLMNKVEEFAK-MTLVLTQEETGQHVRMLPHDMKNSL 121 +H I D+LS T EL+L NK EE + M L+LTQEETG+HVRML H+++++L Sbjct: 106 VHIIPDLLSVKTRELILKNKAEELDREMGLILTQEETGRHVRMLTHEIRSTL 157 >gb|EEF39314.1| ethylene receptor, putative [Ricinus communis] Length = 636 Score = 57.4 bits (137), Expect = 2e-07 Identities = 29/52 (55%), Positives = 40/52 (76%), Gaps = 1/52 (1%) Frame = -3 Query: 273 IHNIIDMLSGNTCELLLMNKVEEFAK-MTLVLTQEETGQHVRMLPHDMKNSL 121 +H I D+LS T EL+L NK EE + M L+LTQEETG+HVRML H+++++L Sbjct: 106 VHIIPDLLSVKTRELILKNKAEELDREMGLILTQEETGRHVRMLTHEIRSTL 157 >gb|AGD95025.1| ethylene receptor 1 [Cucurbita pepo] Length = 637 Score = 57.4 bits (137), Expect = 2e-07 Identities = 29/52 (55%), Positives = 40/52 (76%), Gaps = 1/52 (1%) Frame = -3 Query: 273 IHNIIDMLSGNTCELLLMNKVEEFAK-MTLVLTQEETGQHVRMLPHDMKNSL 121 +H I D+LS T EL+L NK EE + M L+LTQEETG+HVRML H+++++L Sbjct: 107 VHIIPDLLSVKTRELILKNKAEELDREMGLILTQEETGRHVRMLTHEIRSTL 158 >ref|XP_022147113.1| probable ethylene response sensor 1 isoform X2 [Momordica charantia] ref|XP_022147120.1| probable ethylene response sensor 1 isoform X2 [Momordica charantia] gb|ABP35644.1| ethylene receptor [Momordica charantia] Length = 637 Score = 57.4 bits (137), Expect = 2e-07 Identities = 29/52 (55%), Positives = 40/52 (76%), Gaps = 1/52 (1%) Frame = -3 Query: 273 IHNIIDMLSGNTCELLLMNKVEEFAK-MTLVLTQEETGQHVRMLPHDMKNSL 121 +H I D+LS T EL+L NK EE + M L+LTQEETG+HVRML H+++++L Sbjct: 107 VHIIPDLLSVKTRELILKNKAEELDREMGLILTQEETGRHVRMLTHEIRSTL 158 >ref|XP_002523129.2| PREDICTED: ethylene response sensor 1 [Ricinus communis] Length = 639 Score = 57.4 bits (137), Expect = 2e-07 Identities = 29/52 (55%), Positives = 40/52 (76%), Gaps = 1/52 (1%) Frame = -3 Query: 273 IHNIIDMLSGNTCELLLMNKVEEFAK-MTLVLTQEETGQHVRMLPHDMKNSL 121 +H I D+LS T EL+L NK EE + M L+LTQEETG+HVRML H+++++L Sbjct: 109 VHIIPDLLSVKTRELILKNKAEELDREMGLILTQEETGRHVRMLTHEIRSTL 160 >ref|XP_023513638.1| ethylene response sensor 1-like isoform X1 [Cucurbita pepo subsp. pepo] Length = 659 Score = 57.4 bits (137), Expect = 2e-07 Identities = 29/52 (55%), Positives = 40/52 (76%), Gaps = 1/52 (1%) Frame = -3 Query: 273 IHNIIDMLSGNTCELLLMNKVEEFAK-MTLVLTQEETGQHVRMLPHDMKNSL 121 +H I D+LS T EL+L NK EE + M L+LTQEETG+HVRML H+++++L Sbjct: 133 VHIIPDLLSVKTRELILKNKAEELDREMGLILTQEETGRHVRMLTHEIRSTL 184 >ref|XP_023004490.1| ethylene response sensor 1-like isoform X2 [Cucurbita maxima] Length = 671 Score = 57.4 bits (137), Expect = 2e-07 Identities = 29/52 (55%), Positives = 40/52 (76%), Gaps = 1/52 (1%) Frame = -3 Query: 273 IHNIIDMLSGNTCELLLMNKVEEFAK-MTLVLTQEETGQHVRMLPHDMKNSL 121 +H I D+LS T EL+L NK EE + M L+LTQEETG+HVRML H+++++L Sbjct: 145 VHIIPDLLSVKTRELILKNKAEELDREMGLILTQEETGRHVRMLTHEIRSTL 196 >ref|XP_022147103.1| probable ethylene response sensor 1 isoform X1 [Momordica charantia] Length = 676 Score = 57.4 bits (137), Expect = 2e-07 Identities = 29/52 (55%), Positives = 40/52 (76%), Gaps = 1/52 (1%) Frame = -3 Query: 273 IHNIIDMLSGNTCELLLMNKVEEFAK-MTLVLTQEETGQHVRMLPHDMKNSL 121 +H I D+LS T EL+L NK EE + M L+LTQEETG+HVRML H+++++L Sbjct: 146 VHIIPDLLSVKTRELILKNKAEELDREMGLILTQEETGRHVRMLTHEIRSTL 197 >gb|KJB49871.1| hypothetical protein B456_008G143100 [Gossypium raimondii] Length = 428 Score = 56.6 bits (135), Expect = 4e-07 Identities = 29/52 (55%), Positives = 39/52 (75%), Gaps = 1/52 (1%) Frame = -3 Query: 273 IHNIIDMLSGNTCELLLMNKVEEFAK-MTLVLTQEETGQHVRMLPHDMKNSL 121 +H I D+LS T EL L NK EE + M L+LTQEETG+HVRML H+++++L Sbjct: 106 VHIIPDLLSVKTRELFLRNKAEELDREMGLILTQEETGRHVRMLTHEIRSTL 157 >gb|PNT50723.1| hypothetical protein POPTR_002G201500v3 [Populus trichocarpa] Length = 470 Score = 56.6 bits (135), Expect = 4e-07 Identities = 29/52 (55%), Positives = 39/52 (75%), Gaps = 1/52 (1%) Frame = -3 Query: 273 IHNIIDMLSGNTCELLLMNKVEEFAK-MTLVLTQEETGQHVRMLPHDMKNSL 121 +H I D+LS T EL L NK EE + M L+LTQEETG+HVRML H+++++L Sbjct: 106 VHIIPDLLSVKTRELFLKNKAEELDREMGLILTQEETGRHVRMLTHEIRSTL 157 >gb|PNT50721.1| hypothetical protein POPTR_002G201500v3 [Populus trichocarpa] Length = 517 Score = 56.6 bits (135), Expect = 5e-07 Identities = 29/52 (55%), Positives = 39/52 (75%), Gaps = 1/52 (1%) Frame = -3 Query: 273 IHNIIDMLSGNTCELLLMNKVEEFAK-MTLVLTQEETGQHVRMLPHDMKNSL 121 +H I D+LS T EL L NK EE + M L+LTQEETG+HVRML H+++++L Sbjct: 106 VHIIPDLLSVKTRELFLKNKAEELDREMGLILTQEETGRHVRMLTHEIRSTL 157 >gb|PNT50724.1| hypothetical protein POPTR_002G201500v3 [Populus trichocarpa] Length = 557 Score = 56.6 bits (135), Expect = 5e-07 Identities = 29/52 (55%), Positives = 39/52 (75%), Gaps = 1/52 (1%) Frame = -3 Query: 273 IHNIIDMLSGNTCELLLMNKVEEFAK-MTLVLTQEETGQHVRMLPHDMKNSL 121 +H I D+LS T EL L NK EE + M L+LTQEETG+HVRML H+++++L Sbjct: 106 VHIIPDLLSVKTRELFLKNKAEELDREMGLILTQEETGRHVRMLTHEIRSTL 157