BLASTX nr result
ID: Astragalus23_contig00026686
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus23_contig00026686 (357 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004494892.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL... 75 3e-13 gb|PNY13143.1| protein strubbelig-receptor family 6-like, partia... 69 2e-12 ref|XP_013450630.1| strubbelig-receptor family protein [Medicago... 72 2e-12 dbj|GAU46979.1| hypothetical protein TSUD_190160 [Trifolium subt... 71 6e-12 ref|XP_015968283.1| protein STRUBBELIG-RECEPTOR FAMILY 7 [Arachi... 69 4e-11 gb|ATB52987.1| resistance protein, partial [Arachis hypogaea] 68 1e-10 ref|XP_020959884.1| protein STRUBBELIG-RECEPTOR FAMILY 7-like [A... 68 1e-10 ref|XP_019423659.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL... 66 3e-10 gb|OIV95169.1| hypothetical protein TanjilG_21559 [Lupinus angus... 65 6e-10 ref|XP_019418706.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL... 65 6e-10 gb|KRG97278.1| hypothetical protein GLYMA_19G261700 [Glycine max... 65 1e-09 ref|XP_006604928.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL... 65 1e-09 gb|KHN16389.1| Protein STRUBBELIG-RECEPTOR FAMILY 6 [Glycine soja] 65 1e-09 gb|KRH69003.1| hypothetical protein GLYMA_03G262700 [Glycine max] 65 1e-09 ref|XP_020211007.1| protein STRUBBELIG-RECEPTOR FAMILY 6-like [C... 64 2e-09 gb|KYP72017.1| Protein STRUBBELIG-RECEPTOR FAMILY 6 [Cajanus cajan] 64 2e-09 gb|KOM29108.1| hypothetical protein LR48_Vigan635s003300, partia... 62 1e-08 ref|XP_017409859.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL... 62 1e-08 ref|XP_014499061.1| protein STRUBBELIG-RECEPTOR FAMILY 7 [Vigna ... 62 1e-08 gb|AFW90526.1| strubbelig-receptor family 6-like protein [Phaseo... 59 9e-08 >ref|XP_004494892.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6 [Cicer arietinum] Length = 722 Score = 75.1 bits (183), Expect = 3e-13 Identities = 39/43 (90%), Positives = 41/43 (95%) Frame = -3 Query: 355 MSEVVQALVRLVQRANMSRRTFGSDHGGSGSLRGSDEPAIRDI 227 MSEVVQA+VRLVQRANMSRRTFGSDHG GSLRGSDEPAI+DI Sbjct: 682 MSEVVQAMVRLVQRANMSRRTFGSDHG--GSLRGSDEPAIQDI 722 >gb|PNY13143.1| protein strubbelig-receptor family 6-like, partial [Trifolium pratense] Length = 149 Score = 69.3 bits (168), Expect = 2e-12 Identities = 40/45 (88%), Positives = 40/45 (88%), Gaps = 2/45 (4%) Frame = -3 Query: 355 MSEVVQALVRLVQRANMSRRTF--GSDHGGSGSLRGSDEPAIRDI 227 MSEVVQALVRLVQRANMSRRTF GSD GGS LRGSDEPAIRDI Sbjct: 107 MSEVVQALVRLVQRANMSRRTFTFGSDQGGS--LRGSDEPAIRDI 149 >ref|XP_013450630.1| strubbelig-receptor family protein [Medicago truncatula] gb|KEH24658.1| strubbelig-receptor family protein [Medicago truncatula] Length = 723 Score = 72.4 bits (176), Expect = 2e-12 Identities = 41/45 (91%), Positives = 41/45 (91%), Gaps = 2/45 (4%) Frame = -3 Query: 355 MSEVVQALVRLVQRANMSRRTF--GSDHGGSGSLRGSDEPAIRDI 227 MSEVVQALVRLVQRANMSRRTF GSDHGGS LRGSDEPAIRDI Sbjct: 681 MSEVVQALVRLVQRANMSRRTFTFGSDHGGS--LRGSDEPAIRDI 723 >dbj|GAU46979.1| hypothetical protein TSUD_190160 [Trifolium subterraneum] Length = 727 Score = 71.2 bits (173), Expect = 6e-12 Identities = 40/45 (88%), Positives = 41/45 (91%), Gaps = 2/45 (4%) Frame = -3 Query: 355 MSEVVQALVRLVQRANMSRRTF--GSDHGGSGSLRGSDEPAIRDI 227 MSEVVQ+LVRLVQRANMSRRTF GSDHGGS LRGSDEPAIRDI Sbjct: 685 MSEVVQSLVRLVQRANMSRRTFTFGSDHGGS--LRGSDEPAIRDI 727 >ref|XP_015968283.1| protein STRUBBELIG-RECEPTOR FAMILY 7 [Arachis duranensis] Length = 730 Score = 68.9 bits (167), Expect = 4e-11 Identities = 38/44 (86%), Positives = 39/44 (88%), Gaps = 1/44 (2%) Frame = -3 Query: 355 MSEVVQALVRLVQRANMSRR-TFGSDHGGSGSLRGSDEPAIRDI 227 MSEVVQALVRLVQRANMSRR TFGSDHGGS RGSDEPAI D+ Sbjct: 689 MSEVVQALVRLVQRANMSRRTTFGSDHGGSN--RGSDEPAIHDV 730 >gb|ATB52987.1| resistance protein, partial [Arachis hypogaea] Length = 729 Score = 67.8 bits (164), Expect = 1e-10 Identities = 38/43 (88%), Positives = 38/43 (88%), Gaps = 1/43 (2%) Frame = -3 Query: 355 MSEVVQALVRLVQRANMSRR-TFGSDHGGSGSLRGSDEPAIRD 230 MSEVVQALVRLVQRANMSRR TFGSDHGGS RGSDEPAI D Sbjct: 689 MSEVVQALVRLVQRANMSRRTTFGSDHGGSN--RGSDEPAIHD 729 >ref|XP_020959884.1| protein STRUBBELIG-RECEPTOR FAMILY 7-like [Arachis ipaensis] Length = 731 Score = 67.8 bits (164), Expect = 1e-10 Identities = 38/43 (88%), Positives = 38/43 (88%), Gaps = 1/43 (2%) Frame = -3 Query: 355 MSEVVQALVRLVQRANMSRR-TFGSDHGGSGSLRGSDEPAIRD 230 MSEVVQALVRLVQRANMSRR TFGSDHGGS RGSDEPAI D Sbjct: 689 MSEVVQALVRLVQRANMSRRTTFGSDHGGSN--RGSDEPAIHD 729 >ref|XP_019423659.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Lupinus angustifolius] gb|OIW17238.1| hypothetical protein TanjilG_27435 [Lupinus angustifolius] Length = 722 Score = 66.2 bits (160), Expect = 3e-10 Identities = 34/42 (80%), Positives = 38/42 (90%) Frame = -3 Query: 355 MSEVVQALVRLVQRANMSRRTFGSDHGGSGSLRGSDEPAIRD 230 MSEVVQALVRLVQRANMS+RTFGSD GG+ RGSDEP++RD Sbjct: 682 MSEVVQALVRLVQRANMSKRTFGSDQGGTP--RGSDEPSLRD 721 >gb|OIV95169.1| hypothetical protein TanjilG_21559 [Lupinus angustifolius] Length = 492 Score = 65.5 bits (158), Expect = 6e-10 Identities = 33/43 (76%), Positives = 39/43 (90%) Frame = -3 Query: 355 MSEVVQALVRLVQRANMSRRTFGSDHGGSGSLRGSDEPAIRDI 227 MSEVVQALVRLVQRANMSRRTFGSD GG+ RGSD+PA++++ Sbjct: 452 MSEVVQALVRLVQRANMSRRTFGSDQGGTP--RGSDDPALQEV 492 >ref|XP_019418706.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Lupinus angustifolius] Length = 719 Score = 65.5 bits (158), Expect = 6e-10 Identities = 33/43 (76%), Positives = 39/43 (90%) Frame = -3 Query: 355 MSEVVQALVRLVQRANMSRRTFGSDHGGSGSLRGSDEPAIRDI 227 MSEVVQALVRLVQRANMSRRTFGSD GG+ RGSD+PA++++ Sbjct: 679 MSEVVQALVRLVQRANMSRRTFGSDQGGTP--RGSDDPALQEV 719 >gb|KRG97278.1| hypothetical protein GLYMA_19G261700 [Glycine max] gb|KRG97279.1| hypothetical protein GLYMA_19G261700 [Glycine max] Length = 696 Score = 64.7 bits (156), Expect = 1e-09 Identities = 36/44 (81%), Positives = 38/44 (86%), Gaps = 1/44 (2%) Frame = -3 Query: 355 MSEVVQALVRLVQRANMSRRTF-GSDHGGSGSLRGSDEPAIRDI 227 MSEVVQALVRLVQRANMS+RTF SDHG GS RGSDEP +RDI Sbjct: 655 MSEVVQALVRLVQRANMSKRTFSSSDHG--GSQRGSDEPVLRDI 696 >ref|XP_006604928.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6 [Glycine max] gb|KHN11358.1| Protein STRUBBELIG-RECEPTOR FAMILY 6 [Glycine soja] gb|KRG97277.1| hypothetical protein GLYMA_19G261700 [Glycine max] Length = 721 Score = 64.7 bits (156), Expect = 1e-09 Identities = 36/44 (81%), Positives = 38/44 (86%), Gaps = 1/44 (2%) Frame = -3 Query: 355 MSEVVQALVRLVQRANMSRRTF-GSDHGGSGSLRGSDEPAIRDI 227 MSEVVQALVRLVQRANMS+RTF SDHG GS RGSDEP +RDI Sbjct: 680 MSEVVQALVRLVQRANMSKRTFSSSDHG--GSQRGSDEPVLRDI 721 >gb|KHN16389.1| Protein STRUBBELIG-RECEPTOR FAMILY 6 [Glycine soja] Length = 722 Score = 64.7 bits (156), Expect = 1e-09 Identities = 36/44 (81%), Positives = 38/44 (86%), Gaps = 1/44 (2%) Frame = -3 Query: 355 MSEVVQALVRLVQRANMSRRTF-GSDHGGSGSLRGSDEPAIRDI 227 MSEVVQALVRLVQRANMS+RTF SDHG GS RGSDEP +RDI Sbjct: 681 MSEVVQALVRLVQRANMSKRTFSSSDHG--GSQRGSDEPVLRDI 722 >gb|KRH69003.1| hypothetical protein GLYMA_03G262700 [Glycine max] Length = 734 Score = 64.7 bits (156), Expect = 1e-09 Identities = 36/44 (81%), Positives = 38/44 (86%), Gaps = 1/44 (2%) Frame = -3 Query: 355 MSEVVQALVRLVQRANMSRRTF-GSDHGGSGSLRGSDEPAIRDI 227 MSEVVQALVRLVQRANMS+RTF SDHG GS RGSDEP +RDI Sbjct: 693 MSEVVQALVRLVQRANMSKRTFSSSDHG--GSQRGSDEPVLRDI 734 >ref|XP_020211007.1| protein STRUBBELIG-RECEPTOR FAMILY 6-like [Cajanus cajan] Length = 724 Score = 63.9 bits (154), Expect = 2e-09 Identities = 35/44 (79%), Positives = 38/44 (86%), Gaps = 1/44 (2%) Frame = -3 Query: 355 MSEVVQALVRLVQRANMSRRTF-GSDHGGSGSLRGSDEPAIRDI 227 MSEVVQALVRLVQRANMS+RTF SDHG GS RGSDEP +RD+ Sbjct: 683 MSEVVQALVRLVQRANMSKRTFSSSDHG--GSQRGSDEPVLRDL 724 >gb|KYP72017.1| Protein STRUBBELIG-RECEPTOR FAMILY 6 [Cajanus cajan] Length = 780 Score = 63.9 bits (154), Expect = 2e-09 Identities = 35/44 (79%), Positives = 38/44 (86%), Gaps = 1/44 (2%) Frame = -3 Query: 355 MSEVVQALVRLVQRANMSRRTF-GSDHGGSGSLRGSDEPAIRDI 227 MSEVVQALVRLVQRANMS+RTF SDHG GS RGSDEP +RD+ Sbjct: 739 MSEVVQALVRLVQRANMSKRTFSSSDHG--GSQRGSDEPVLRDL 780 >gb|KOM29108.1| hypothetical protein LR48_Vigan635s003300, partial [Vigna angularis] Length = 624 Score = 61.6 bits (148), Expect = 1e-08 Identities = 35/44 (79%), Positives = 38/44 (86%), Gaps = 1/44 (2%) Frame = -3 Query: 355 MSEVVQALVRLVQRANMSRRTF-GSDHGGSGSLRGSDEPAIRDI 227 MSEVVQALVRLVQRANMS+RTF SDHG GS RGSDE A+R+I Sbjct: 583 MSEVVQALVRLVQRANMSKRTFSSSDHG--GSQRGSDEAALREI 624 >ref|XP_017409859.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 7-like [Vigna angularis] dbj|BAT80386.1| hypothetical protein VIGAN_02339500 [Vigna angularis var. angularis] Length = 724 Score = 61.6 bits (148), Expect = 1e-08 Identities = 35/44 (79%), Positives = 38/44 (86%), Gaps = 1/44 (2%) Frame = -3 Query: 355 MSEVVQALVRLVQRANMSRRTF-GSDHGGSGSLRGSDEPAIRDI 227 MSEVVQALVRLVQRANMS+RTF SDHG GS RGSDE A+R+I Sbjct: 683 MSEVVQALVRLVQRANMSKRTFSSSDHG--GSQRGSDEAALREI 724 >ref|XP_014499061.1| protein STRUBBELIG-RECEPTOR FAMILY 7 [Vigna radiata var. radiata] Length = 724 Score = 61.6 bits (148), Expect = 1e-08 Identities = 35/44 (79%), Positives = 38/44 (86%), Gaps = 1/44 (2%) Frame = -3 Query: 355 MSEVVQALVRLVQRANMSRRTF-GSDHGGSGSLRGSDEPAIRDI 227 MSEVVQALVRLVQRANMS+RTF SDHG GS RGSDE A+R+I Sbjct: 683 MSEVVQALVRLVQRANMSKRTFSSSDHG--GSQRGSDEAALREI 724 >gb|AFW90526.1| strubbelig-receptor family 6-like protein [Phaseolus vulgaris] Length = 662 Score = 59.3 bits (142), Expect = 9e-08 Identities = 33/43 (76%), Positives = 36/43 (83%) Frame = -3 Query: 355 MSEVVQALVRLVQRANMSRRTFGSDHGGSGSLRGSDEPAIRDI 227 MSEVVQALVRLVQRANMS+RTF S G GS RGSDE A+R+I Sbjct: 621 MSEVVQALVRLVQRANMSKRTFSSSDLG-GSQRGSDEAALREI 662