BLASTX nr result
ID: Astragalus23_contig00026416
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus23_contig00026416 (292 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003594801.1| myb transcription factor [Medicago truncatul... 60 1e-08 >ref|XP_003594801.1| myb transcription factor [Medicago truncatula] gb|AES65052.1| myb transcription factor [Medicago truncatula] Length = 332 Score = 60.5 bits (145), Expect = 1e-08 Identities = 45/80 (56%), Positives = 53/80 (66%), Gaps = 1/80 (1%) Frame = +1 Query: 1 RKIYCYMRSMNESPPPLDMPTVTEASTSKRSSNQGTKNINPXXXXXXXXHATLIQNSLNE 180 RKIYC+MRS+NESPPPLDM ASTSK + NQG N NP +LIQNSL E Sbjct: 114 RKIYCFMRSINESPPPLDM-----ASTSK-TINQGKIN-NPSIEEDNG--MSLIQNSL-E 163 Query: 181 LMPKEISTSQSCSI-GDEEI 237 MPKE +TSQ ++ G E+I Sbjct: 164 PMPKEKTTSQYYNVQGVEDI 183