BLASTX nr result
ID: Astragalus23_contig00026200
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus23_contig00026200 (348 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PNX75347.1| geminivirus rep-interacting motor [Trifolium prat... 64 3e-09 gb|PNX75495.1| hypothetical protein L195_g031432 [Trifolium prat... 57 2e-07 >gb|PNX75347.1| geminivirus rep-interacting motor [Trifolium pratense] Length = 541 Score = 63.5 bits (153), Expect = 3e-09 Identities = 31/61 (50%), Positives = 46/61 (75%) Frame = -3 Query: 346 DQELAKNTRSVHVIHNMVQPTLDGYNVSILAYGQTHFERTHIMEELSFGWVFNDLFLFKN 167 DQ L +TRSV V+H+MVQPTLD YN S+LAYGQ H +T+ ME++S+ +F+++ F+ Sbjct: 322 DQGLVTSTRSVIVVHHMVQPTLDRYNSSMLAYGQNHSGKTNFMEKVSYD-LFHNVSCFER 380 Query: 166 M 164 + Sbjct: 381 V 381 >gb|PNX75495.1| hypothetical protein L195_g031432 [Trifolium pratense] Length = 214 Score = 57.4 bits (137), Expect = 2e-07 Identities = 26/47 (55%), Positives = 36/47 (76%) Frame = -3 Query: 346 DQELAKNTRSVHVIHNMVQPTLDGYNVSILAYGQTHFERTHIMEELS 206 +Q L K TR+ +IH M+QP LD Y+VSI+AYGQ H E+THIM +++ Sbjct: 74 EQGLEKYTRAAIIIHYMMQPCLDRYDVSIVAYGQNHSEKTHIMVDVA 120