BLASTX nr result
ID: Astragalus23_contig00026089
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus23_contig00026089 (452 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_014491926.1| interactor of constitutive active ROPs 2, ch... 139 2e-35 gb|KYP43922.1| hypothetical protein KK1_034604 [Cajanus cajan] 138 2e-35 ref|XP_020238115.1| interactor of constitutive active ROPs 2, ch... 138 2e-35 ref|XP_016184886.1| interactor of constitutive active ROPs 2, ch... 138 3e-35 ref|XP_015937995.1| interactor of constitutive active ROPs 2, ch... 138 3e-35 ref|XP_016184883.1| interactor of constitutive active ROPs 2, ch... 138 3e-35 ref|XP_015937991.1| interactor of constitutive active ROPs 2, ch... 138 3e-35 ref|XP_007144532.1| hypothetical protein PHAVU_007G163800g [Phas... 138 3e-35 dbj|GAU26745.1| hypothetical protein TSUD_317430 [Trifolium subt... 137 4e-35 ref|XP_006594118.1| PREDICTED: interactor of constitutive active... 137 5e-35 ref|XP_003542499.1| PREDICTED: interactor of constitutive active... 137 5e-35 gb|KHN48324.1| Interactor of constitutive active ROPs 2, chlorop... 137 5e-35 ref|XP_017405929.1| PREDICTED: interactor of constitutive active... 137 7e-35 ref|XP_019428539.1| PREDICTED: interactor of constitutive active... 135 5e-34 ref|XP_019428537.1| PREDICTED: interactor of constitutive active... 135 5e-34 gb|PNY06087.1| interactor of constitutive active ROPs-like prote... 134 1e-33 ref|XP_019433286.1| PREDICTED: interactor of constitutive active... 132 1e-33 ref|XP_006588764.1| PREDICTED: interactor of constitutive active... 133 2e-33 gb|KHN39107.1| Interactor of constitutive active ROPs 2, chlorop... 133 2e-33 ref|XP_006588759.1| PREDICTED: interactor of constitutive active... 133 2e-33 >ref|XP_014491926.1| interactor of constitutive active ROPs 2, chloroplastic [Vigna radiata var. radiata] ref|XP_014491927.1| interactor of constitutive active ROPs 2, chloroplastic [Vigna radiata var. radiata] ref|XP_014491928.1| interactor of constitutive active ROPs 2, chloroplastic [Vigna radiata var. radiata] ref|XP_022633668.1| interactor of constitutive active ROPs 2, chloroplastic [Vigna radiata var. radiata] ref|XP_022633669.1| interactor of constitutive active ROPs 2, chloroplastic [Vigna radiata var. radiata] Length = 622 Score = 139 bits (349), Expect = 2e-35 Identities = 66/82 (80%), Positives = 71/82 (86%) Frame = +1 Query: 1 AELRRLKVQSDQWRKXXXXXXXMLSSGNNGKIVERTGSLDSGYNSINGKLSSPYSEDTDD 180 AELRRLKVQSDQWRK M+S+GNNGK VERTGSLDS YN+I+ K+SSPYSEDTDD Sbjct: 541 AELRRLKVQSDQWRKAAEAAAAMISAGNNGKFVERTGSLDSSYNTISAKMSSPYSEDTDD 600 Query: 181 DSPKKKNTTMLKKIGVLWKKNH 246 DSPKKKNT MLKKIGVLWKKNH Sbjct: 601 DSPKKKNTNMLKKIGVLWKKNH 622 >gb|KYP43922.1| hypothetical protein KK1_034604 [Cajanus cajan] Length = 579 Score = 138 bits (348), Expect = 2e-35 Identities = 66/82 (80%), Positives = 70/82 (85%) Frame = +1 Query: 1 AELRRLKVQSDQWRKXXXXXXXMLSSGNNGKIVERTGSLDSGYNSINGKLSSPYSEDTDD 180 AELRRLKVQSDQWRK M+S+GNNGK VERTGSLD+ YNSI K+SSPYSEDTDD Sbjct: 498 AELRRLKVQSDQWRKAAEAAAAMISAGNNGKFVERTGSLDNSYNSITAKMSSPYSEDTDD 557 Query: 181 DSPKKKNTTMLKKIGVLWKKNH 246 DSPKKKNT MLKKIGVLWKKNH Sbjct: 558 DSPKKKNTNMLKKIGVLWKKNH 579 >ref|XP_020238115.1| interactor of constitutive active ROPs 2, chloroplastic-like [Cajanus cajan] ref|XP_020238116.1| interactor of constitutive active ROPs 2, chloroplastic-like [Cajanus cajan] ref|XP_020238117.1| interactor of constitutive active ROPs 2, chloroplastic-like [Cajanus cajan] ref|XP_020238118.1| interactor of constitutive active ROPs 2, chloroplastic-like [Cajanus cajan] ref|XP_020238119.1| interactor of constitutive active ROPs 2, chloroplastic-like [Cajanus cajan] ref|XP_020238121.1| interactor of constitutive active ROPs 2, chloroplastic-like [Cajanus cajan] Length = 600 Score = 138 bits (348), Expect = 2e-35 Identities = 66/82 (80%), Positives = 70/82 (85%) Frame = +1 Query: 1 AELRRLKVQSDQWRKXXXXXXXMLSSGNNGKIVERTGSLDSGYNSINGKLSSPYSEDTDD 180 AELRRLKVQSDQWRK M+S+GNNGK VERTGSLD+ YNSI K+SSPYSEDTDD Sbjct: 519 AELRRLKVQSDQWRKAAEAAAAMISAGNNGKFVERTGSLDNSYNSITAKMSSPYSEDTDD 578 Query: 181 DSPKKKNTTMLKKIGVLWKKNH 246 DSPKKKNT MLKKIGVLWKKNH Sbjct: 579 DSPKKKNTNMLKKIGVLWKKNH 600 >ref|XP_016184886.1| interactor of constitutive active ROPs 2, chloroplastic isoform X2 [Arachis ipaensis] ref|XP_020972438.1| interactor of constitutive active ROPs 2, chloroplastic isoform X2 [Arachis ipaensis] Length = 611 Score = 138 bits (348), Expect = 3e-35 Identities = 65/82 (79%), Positives = 72/82 (87%) Frame = +1 Query: 1 AELRRLKVQSDQWRKXXXXXXXMLSSGNNGKIVERTGSLDSGYNSINGKLSSPYSEDTDD 180 AELRRLKVQSDQWRK +LS+GNNGK+VERTGSLD+ +NSI GK++SPYSEDTDD Sbjct: 530 AELRRLKVQSDQWRKAAEAAATILSAGNNGKVVERTGSLDNNFNSITGKMTSPYSEDTDD 589 Query: 181 DSPKKKNTTMLKKIGVLWKKNH 246 DSPKKKNT MLKKIGVLWKKNH Sbjct: 590 DSPKKKNTNMLKKIGVLWKKNH 611 >ref|XP_015937995.1| interactor of constitutive active ROPs 2, chloroplastic isoform X2 [Arachis duranensis] ref|XP_020986088.1| interactor of constitutive active ROPs 2, chloroplastic isoform X2 [Arachis duranensis] Length = 611 Score = 138 bits (348), Expect = 3e-35 Identities = 65/82 (79%), Positives = 72/82 (87%) Frame = +1 Query: 1 AELRRLKVQSDQWRKXXXXXXXMLSSGNNGKIVERTGSLDSGYNSINGKLSSPYSEDTDD 180 AELRRLKVQSDQWRK +LS+GNNGK+VERTGSLD+ +NSI GK++SPYSEDTDD Sbjct: 530 AELRRLKVQSDQWRKAAEAAATILSAGNNGKVVERTGSLDNNFNSITGKMTSPYSEDTDD 589 Query: 181 DSPKKKNTTMLKKIGVLWKKNH 246 DSPKKKNT MLKKIGVLWKKNH Sbjct: 590 DSPKKKNTNMLKKIGVLWKKNH 611 >ref|XP_016184883.1| interactor of constitutive active ROPs 2, chloroplastic isoform X1 [Arachis ipaensis] ref|XP_016184885.1| interactor of constitutive active ROPs 2, chloroplastic isoform X1 [Arachis ipaensis] Length = 623 Score = 138 bits (348), Expect = 3e-35 Identities = 65/82 (79%), Positives = 72/82 (87%) Frame = +1 Query: 1 AELRRLKVQSDQWRKXXXXXXXMLSSGNNGKIVERTGSLDSGYNSINGKLSSPYSEDTDD 180 AELRRLKVQSDQWRK +LS+GNNGK+VERTGSLD+ +NSI GK++SPYSEDTDD Sbjct: 542 AELRRLKVQSDQWRKAAEAAATILSAGNNGKVVERTGSLDNNFNSITGKMTSPYSEDTDD 601 Query: 181 DSPKKKNTTMLKKIGVLWKKNH 246 DSPKKKNT MLKKIGVLWKKNH Sbjct: 602 DSPKKKNTNMLKKIGVLWKKNH 623 >ref|XP_015937991.1| interactor of constitutive active ROPs 2, chloroplastic isoform X1 [Arachis duranensis] ref|XP_015937993.1| interactor of constitutive active ROPs 2, chloroplastic isoform X1 [Arachis duranensis] Length = 623 Score = 138 bits (348), Expect = 3e-35 Identities = 65/82 (79%), Positives = 72/82 (87%) Frame = +1 Query: 1 AELRRLKVQSDQWRKXXXXXXXMLSSGNNGKIVERTGSLDSGYNSINGKLSSPYSEDTDD 180 AELRRLKVQSDQWRK +LS+GNNGK+VERTGSLD+ +NSI GK++SPYSEDTDD Sbjct: 542 AELRRLKVQSDQWRKAAEAAATILSAGNNGKVVERTGSLDNNFNSITGKMTSPYSEDTDD 601 Query: 181 DSPKKKNTTMLKKIGVLWKKNH 246 DSPKKKNT MLKKIGVLWKKNH Sbjct: 602 DSPKKKNTNMLKKIGVLWKKNH 623 >ref|XP_007144532.1| hypothetical protein PHAVU_007G163800g [Phaseolus vulgaris] gb|ESW16526.1| hypothetical protein PHAVU_007G163800g [Phaseolus vulgaris] Length = 609 Score = 138 bits (347), Expect = 3e-35 Identities = 66/82 (80%), Positives = 70/82 (85%) Frame = +1 Query: 1 AELRRLKVQSDQWRKXXXXXXXMLSSGNNGKIVERTGSLDSGYNSINGKLSSPYSEDTDD 180 AELRRLKVQSDQWRK M+S+GNNGK VERTGSLDS YNSI K+SSP+SEDTDD Sbjct: 528 AELRRLKVQSDQWRKAAEAAAAMISAGNNGKFVERTGSLDSNYNSIGAKMSSPFSEDTDD 587 Query: 181 DSPKKKNTTMLKKIGVLWKKNH 246 DSPKKKNT MLKKIGVLWKKNH Sbjct: 588 DSPKKKNTNMLKKIGVLWKKNH 609 >dbj|GAU26745.1| hypothetical protein TSUD_317430 [Trifolium subterraneum] Length = 584 Score = 137 bits (346), Expect = 4e-35 Identities = 68/84 (80%), Positives = 72/84 (85%), Gaps = 2/84 (2%) Frame = +1 Query: 1 AELRRLKVQSDQWRKXXXXXXXMLSSGNNGKIVERTGSLDSGYNS--INGKLSSPYSEDT 174 AELRRLKVQSDQWRK M+SSGNNGKIVERTG LDSGYN+ + K+SSPYSEDT Sbjct: 500 AELRRLKVQSDQWRKAAEAAAAMISSGNNGKIVERTGLLDSGYNNSIVGNKMSSPYSEDT 559 Query: 175 DDDSPKKKNTTMLKKIGVLWKKNH 246 DDDSPKKKNTTMLKKIGVLWKKNH Sbjct: 560 DDDSPKKKNTTMLKKIGVLWKKNH 583 >ref|XP_006594118.1| PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like isoform X2 [Glycine max] ref|XP_006594119.1| PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like isoform X2 [Glycine max] gb|KRH19815.1| hypothetical protein GLYMA_13G137200 [Glycine max] gb|KRH19816.1| hypothetical protein GLYMA_13G137200 [Glycine max] Length = 623 Score = 137 bits (346), Expect = 5e-35 Identities = 66/82 (80%), Positives = 70/82 (85%) Frame = +1 Query: 1 AELRRLKVQSDQWRKXXXXXXXMLSSGNNGKIVERTGSLDSGYNSINGKLSSPYSEDTDD 180 AELRRLKVQSDQWRK M+S+GNNGK VERTGSLDS YNSI K+SSPYSE+TDD Sbjct: 542 AELRRLKVQSDQWRKAAEAAAAMISAGNNGKFVERTGSLDSSYNSITAKMSSPYSENTDD 601 Query: 181 DSPKKKNTTMLKKIGVLWKKNH 246 DSPKKKNT MLKKIGVLWKKNH Sbjct: 602 DSPKKKNTNMLKKIGVLWKKNH 623 >ref|XP_003542499.1| PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like isoform X1 [Glycine max] ref|XP_006594115.1| PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like isoform X1 [Glycine max] ref|XP_006594116.1| PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like isoform X1 [Glycine max] ref|XP_006594117.1| PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like isoform X1 [Glycine max] gb|KRH19817.1| hypothetical protein GLYMA_13G137200 [Glycine max] gb|KRH19818.1| hypothetical protein GLYMA_13G137200 [Glycine max] gb|KRH19819.1| hypothetical protein GLYMA_13G137200 [Glycine max] gb|KRH19820.1| hypothetical protein GLYMA_13G137200 [Glycine max] Length = 624 Score = 137 bits (346), Expect = 5e-35 Identities = 66/82 (80%), Positives = 70/82 (85%) Frame = +1 Query: 1 AELRRLKVQSDQWRKXXXXXXXMLSSGNNGKIVERTGSLDSGYNSINGKLSSPYSEDTDD 180 AELRRLKVQSDQWRK M+S+GNNGK VERTGSLDS YNSI K+SSPYSE+TDD Sbjct: 543 AELRRLKVQSDQWRKAAEAAAAMISAGNNGKFVERTGSLDSSYNSITAKMSSPYSENTDD 602 Query: 181 DSPKKKNTTMLKKIGVLWKKNH 246 DSPKKKNT MLKKIGVLWKKNH Sbjct: 603 DSPKKKNTNMLKKIGVLWKKNH 624 >gb|KHN48324.1| Interactor of constitutive active ROPs 2, chloroplastic [Glycine soja] Length = 625 Score = 137 bits (346), Expect = 5e-35 Identities = 66/82 (80%), Positives = 70/82 (85%) Frame = +1 Query: 1 AELRRLKVQSDQWRKXXXXXXXMLSSGNNGKIVERTGSLDSGYNSINGKLSSPYSEDTDD 180 AELRRLKVQSDQWRK M+S+GNNGK VERTGSLDS YNSI K+SSPYSE+TDD Sbjct: 544 AELRRLKVQSDQWRKAAEAAAAMISAGNNGKFVERTGSLDSSYNSITAKMSSPYSENTDD 603 Query: 181 DSPKKKNTTMLKKIGVLWKKNH 246 DSPKKKNT MLKKIGVLWKKNH Sbjct: 604 DSPKKKNTNMLKKIGVLWKKNH 625 >ref|XP_017405929.1| PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like [Vigna angularis] ref|XP_017405930.1| PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like [Vigna angularis] ref|XP_017405932.1| PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like [Vigna angularis] ref|XP_017405933.1| PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like [Vigna angularis] gb|KOM25842.1| hypothetical protein LR48_Vigan197s001100 [Vigna angularis] dbj|BAT95895.1| hypothetical protein VIGAN_08272500 [Vigna angularis var. angularis] Length = 622 Score = 137 bits (345), Expect = 7e-35 Identities = 65/82 (79%), Positives = 71/82 (86%) Frame = +1 Query: 1 AELRRLKVQSDQWRKXXXXXXXMLSSGNNGKIVERTGSLDSGYNSINGKLSSPYSEDTDD 180 AELRRLKVQS+QWRK M+S+GNNGK VERTGSLDS YN+I+ K+SSPYSEDTDD Sbjct: 541 AELRRLKVQSEQWRKAAEAAAAMISAGNNGKFVERTGSLDSSYNTISAKMSSPYSEDTDD 600 Query: 181 DSPKKKNTTMLKKIGVLWKKNH 246 DSPKKKNT MLKKIGVLWKKNH Sbjct: 601 DSPKKKNTNMLKKIGVLWKKNH 622 >ref|XP_019428539.1| PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like isoform X2 [Lupinus angustifolius] Length = 624 Score = 135 bits (339), Expect = 5e-34 Identities = 67/86 (77%), Positives = 73/86 (84%), Gaps = 4/86 (4%) Frame = +1 Query: 1 AELRRLKVQSDQWRKXXXXXXXMLSSGNNGKIVERTGSLDSGYNS----INGKLSSPYSE 168 AELRRLKVQSDQWRK MLS+GNNGK+VERTGSLDS YNS INGK+SSPYSE Sbjct: 539 AELRRLKVQSDQWRKAAEAAAAMLSNGNNGKLVERTGSLDSSYNSSYSSINGKMSSPYSE 598 Query: 169 DTDDDSPKKKNTTMLKKIGVLWKKNH 246 DTDD+SPKKKN+ MLKKIGVLWKK+H Sbjct: 599 DTDDESPKKKNSNMLKKIGVLWKKSH 624 >ref|XP_019428537.1| PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like isoform X1 [Lupinus angustifolius] ref|XP_019428538.1| PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like isoform X1 [Lupinus angustifolius] gb|OIV90488.1| hypothetical protein TanjilG_18672 [Lupinus angustifolius] Length = 625 Score = 135 bits (339), Expect = 5e-34 Identities = 67/86 (77%), Positives = 73/86 (84%), Gaps = 4/86 (4%) Frame = +1 Query: 1 AELRRLKVQSDQWRKXXXXXXXMLSSGNNGKIVERTGSLDSGYNS----INGKLSSPYSE 168 AELRRLKVQSDQWRK MLS+GNNGK+VERTGSLDS YNS INGK+SSPYSE Sbjct: 540 AELRRLKVQSDQWRKAAEAAAAMLSNGNNGKLVERTGSLDSSYNSSYSSINGKMSSPYSE 599 Query: 169 DTDDDSPKKKNTTMLKKIGVLWKKNH 246 DTDD+SPKKKN+ MLKKIGVLWKK+H Sbjct: 600 DTDDESPKKKNSNMLKKIGVLWKKSH 625 >gb|PNY06087.1| interactor of constitutive active ROPs-like protein [Trifolium pratense] Length = 668 Score = 134 bits (337), Expect = 1e-33 Identities = 69/84 (82%), Positives = 73/84 (86%), Gaps = 2/84 (2%) Frame = +1 Query: 1 AELRRLKVQSDQWRKXXXXXXXMLSSGNNGKIVERTGSLDSGYN-SING-KLSSPYSEDT 174 AELRRLKVQSDQWRK M+SSGNNGKIVERTG ++SGYN SI G K+SSPYSEDT Sbjct: 584 AELRRLKVQSDQWRKAAEAAAAMISSGNNGKIVERTGLIESGYNNSIPGNKMSSPYSEDT 643 Query: 175 DDDSPKKKNTTMLKKIGVLWKKNH 246 DDDSPKKKNTTMLKKIGVLWKKNH Sbjct: 644 DDDSPKKKNTTMLKKIGVLWKKNH 667 >ref|XP_019433286.1| PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like isoform X2 [Lupinus angustifolius] Length = 448 Score = 132 bits (331), Expect = 1e-33 Identities = 63/82 (76%), Positives = 67/82 (81%) Frame = +1 Query: 1 AELRRLKVQSDQWRKXXXXXXXMLSSGNNGKIVERTGSLDSGYNSINGKLSSPYSEDTDD 180 AELRRLKVQSDQWRK MLS GNNGK VER G LDS +NS+ GK++SPYSED DD Sbjct: 366 AELRRLKVQSDQWRKAAEAAASMLSPGNNGKFVERNGLLDSSFNSVTGKVNSPYSEDMDD 425 Query: 181 DSPKKKNTTMLKKIGVLWKKNH 246 DSPKKKNT MLKKIGVLWKKNH Sbjct: 426 DSPKKKNTNMLKKIGVLWKKNH 447 >ref|XP_006588764.1| PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like isoform X2 [Glycine max] gb|KRH32408.1| hypothetical protein GLYMA_10G049600 [Glycine max] gb|KRH32409.1| hypothetical protein GLYMA_10G049600 [Glycine max] Length = 625 Score = 133 bits (335), Expect = 2e-33 Identities = 66/83 (79%), Positives = 69/83 (83%), Gaps = 1/83 (1%) Frame = +1 Query: 1 AELRRLKVQSDQWRKXXXXXXXMLSSGNNGKIVERTGSLDSGYNSINGKLSSPYSEDT-D 177 AELRRLKVQSDQWRK M+SSGNNGK VERTGSLDS YNS+ K+SSPYSEDT D Sbjct: 543 AELRRLKVQSDQWRKAAEAAAAMISSGNNGKFVERTGSLDSSYNSVTAKMSSPYSEDTDD 602 Query: 178 DDSPKKKNTTMLKKIGVLWKKNH 246 DDSPKKKNT MLKKIGVLWKK H Sbjct: 603 DDSPKKKNTNMLKKIGVLWKKTH 625 >gb|KHN39107.1| Interactor of constitutive active ROPs 2, chloroplastic [Glycine soja] Length = 626 Score = 133 bits (335), Expect = 2e-33 Identities = 66/83 (79%), Positives = 69/83 (83%), Gaps = 1/83 (1%) Frame = +1 Query: 1 AELRRLKVQSDQWRKXXXXXXXMLSSGNNGKIVERTGSLDSGYNSINGKLSSPYSEDT-D 177 AELRRLKVQSDQWRK M+SSGNNGK VERTGSLDS YNS+ K+SSPYSEDT D Sbjct: 544 AELRRLKVQSDQWRKAAEAAAAMISSGNNGKFVERTGSLDSSYNSVTAKMSSPYSEDTDD 603 Query: 178 DDSPKKKNTTMLKKIGVLWKKNH 246 DDSPKKKNT MLKKIGVLWKK H Sbjct: 604 DDSPKKKNTNMLKKIGVLWKKTH 626 >ref|XP_006588759.1| PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like isoform X1 [Glycine max] ref|XP_006588760.1| PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like isoform X1 [Glycine max] ref|XP_006588761.1| PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like isoform X1 [Glycine max] ref|XP_006588762.1| PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like isoform X1 [Glycine max] ref|XP_006588763.1| PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like isoform X1 [Glycine max] ref|XP_014618467.1| PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like isoform X1 [Glycine max] ref|XP_014618468.1| PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like isoform X1 [Glycine max] ref|XP_014618469.1| PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like isoform X1 [Glycine max] ref|XP_014618470.1| PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like isoform X1 [Glycine max] gb|KRH32410.1| hypothetical protein GLYMA_10G049600 [Glycine max] gb|KRH32411.1| hypothetical protein GLYMA_10G049600 [Glycine max] gb|KRH32412.1| hypothetical protein GLYMA_10G049600 [Glycine max] gb|KRH32413.1| hypothetical protein GLYMA_10G049600 [Glycine max] Length = 626 Score = 133 bits (335), Expect = 2e-33 Identities = 66/83 (79%), Positives = 69/83 (83%), Gaps = 1/83 (1%) Frame = +1 Query: 1 AELRRLKVQSDQWRKXXXXXXXMLSSGNNGKIVERTGSLDSGYNSINGKLSSPYSEDT-D 177 AELRRLKVQSDQWRK M+SSGNNGK VERTGSLDS YNS+ K+SSPYSEDT D Sbjct: 544 AELRRLKVQSDQWRKAAEAAAAMISSGNNGKFVERTGSLDSSYNSVTAKMSSPYSEDTDD 603 Query: 178 DDSPKKKNTTMLKKIGVLWKKNH 246 DDSPKKKNT MLKKIGVLWKK H Sbjct: 604 DDSPKKKNTNMLKKIGVLWKKTH 626