BLASTX nr result
ID: Astragalus23_contig00025450
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus23_contig00025450 (319 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_023538068.1| thioredoxin-like protein CITRX, chloroplasti... 75 1e-14 ref|XP_022951386.1| thioredoxin-like protein CITRX, chloroplasti... 75 1e-14 ref|XP_023002069.1| thioredoxin-like protein CITRX, chloroplasti... 75 2e-14 ref|XP_004498688.1| PREDICTED: thioredoxin-like protein CITRX, c... 74 4e-14 gb|OAY53374.1| hypothetical protein MANES_04G158100, partial [Ma... 72 5e-14 ref|XP_021609174.1| thioredoxin-like protein CITRX, chloroplasti... 72 6e-14 gb|OMO87364.1| Thioredoxin [Corchorus olitorius] 70 8e-14 ref|XP_022131323.1| thioredoxin-like protein CITRX, chloroplasti... 73 8e-14 ref|XP_012068680.1| thioredoxin-like protein CITRX, chloroplasti... 73 1e-13 ref|XP_019456520.1| PREDICTED: thioredoxin-like protein CITRX2, ... 72 2e-13 ref|XP_004146769.1| PREDICTED: thioredoxin-like protein CITRX, c... 72 2e-13 ref|XP_013644008.1| thioredoxin-like protein CITRX, chloroplasti... 69 3e-13 ref|XP_013466891.1| thioredoxin-like protein [Medicago truncatul... 72 3e-13 ref|XP_008445409.1| PREDICTED: thioredoxin-like protein CITRX, c... 71 4e-13 gb|EOY19739.1| Thioredoxin z, P,TRX z isoform 2 [Theobroma cacao] 70 4e-13 ref|XP_021888350.1| thioredoxin-like protein CITRX, chloroplasti... 71 6e-13 gb|KFK38136.1| hypothetical protein AALP_AA3G074300 [Arabis alpina] 71 6e-13 gb|AFK49499.1| unknown [Lotus japonicus] 71 7e-13 gb|AFK47218.1| unknown [Lotus japonicus] 71 7e-13 ref|XP_015570810.1| PREDICTED: thioredoxin-like protein CITRX, c... 71 7e-13 >ref|XP_023538068.1| thioredoxin-like protein CITRX, chloroplastic [Cucurbita pepo subsp. pepo] Length = 177 Score = 75.1 bits (183), Expect = 1e-14 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = -2 Query: 318 GLPTLFFVSPDPKKEAIRTEGLIPIQMMRDIIDKEM 211 GLPTLFF+SPDPKKEAIRTEGLIPIQMMRDIIDKEM Sbjct: 142 GLPTLFFISPDPKKEAIRTEGLIPIQMMRDIIDKEM 177 >ref|XP_022951386.1| thioredoxin-like protein CITRX, chloroplastic [Cucurbita moschata] Length = 178 Score = 75.1 bits (183), Expect = 1e-14 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = -2 Query: 318 GLPTLFFVSPDPKKEAIRTEGLIPIQMMRDIIDKEM 211 GLPTLFF+SPDPKKEAIRTEGLIPIQMMRDIIDKEM Sbjct: 143 GLPTLFFISPDPKKEAIRTEGLIPIQMMRDIIDKEM 178 >ref|XP_023002069.1| thioredoxin-like protein CITRX, chloroplastic [Cucurbita maxima] Length = 184 Score = 75.1 bits (183), Expect = 2e-14 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = -2 Query: 318 GLPTLFFVSPDPKKEAIRTEGLIPIQMMRDIIDKEM 211 GLPTLFF+SPDPKKEAIRTEGLIPIQMMRDIIDKEM Sbjct: 149 GLPTLFFISPDPKKEAIRTEGLIPIQMMRDIIDKEM 184 >ref|XP_004498688.1| PREDICTED: thioredoxin-like protein CITRX, chloroplastic [Cicer arietinum] Length = 178 Score = 73.9 bits (180), Expect = 4e-14 Identities = 34/36 (94%), Positives = 36/36 (100%) Frame = -2 Query: 318 GLPTLFFVSPDPKKEAIRTEGLIPIQMMRDIIDKEM 211 GLPTLFF+SPDPKK+AIRTEGLIPIQMMRDIIDKEM Sbjct: 143 GLPTLFFISPDPKKDAIRTEGLIPIQMMRDIIDKEM 178 >gb|OAY53374.1| hypothetical protein MANES_04G158100, partial [Manihot esculenta] Length = 114 Score = 72.0 bits (175), Expect = 5e-14 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = -2 Query: 318 GLPTLFFVSPDPKKEAIRTEGLIPIQMMRDIIDKEM 211 GLPTLFF+SPDPKK+AIR EGLIPIQMMRDIIDKEM Sbjct: 79 GLPTLFFISPDPKKDAIRAEGLIPIQMMRDIIDKEM 114 >ref|XP_021609174.1| thioredoxin-like protein CITRX, chloroplastic [Manihot esculenta] Length = 121 Score = 72.0 bits (175), Expect = 6e-14 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = -2 Query: 318 GLPTLFFVSPDPKKEAIRTEGLIPIQMMRDIIDKEM 211 GLPTLFF+SPDPKK+AIR EGLIPIQMMRDIIDKEM Sbjct: 86 GLPTLFFISPDPKKDAIRAEGLIPIQMMRDIIDKEM 121 >gb|OMO87364.1| Thioredoxin [Corchorus olitorius] Length = 76 Score = 70.5 bits (171), Expect = 8e-14 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = -2 Query: 318 GLPTLFFVSPDPKKEAIRTEGLIPIQMMRDIIDKEM 211 GLPTLFF+SPDP KEAIRTEGLIPIQMMRDI+D EM Sbjct: 41 GLPTLFFISPDPNKEAIRTEGLIPIQMMRDILDNEM 76 >ref|XP_022131323.1| thioredoxin-like protein CITRX, chloroplastic [Momordica charantia] Length = 183 Score = 73.2 bits (178), Expect = 8e-14 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = -2 Query: 318 GLPTLFFVSPDPKKEAIRTEGLIPIQMMRDIIDKEM 211 GLPTLFF+SPDP KEAIRTEGLIPIQMMRDIIDKEM Sbjct: 148 GLPTLFFISPDPSKEAIRTEGLIPIQMMRDIIDKEM 183 >ref|XP_012068680.1| thioredoxin-like protein CITRX, chloroplastic [Jatropha curcas] gb|KDP40544.1| hypothetical protein JCGZ_24543 [Jatropha curcas] Length = 188 Score = 72.8 bits (177), Expect = 1e-13 Identities = 33/36 (91%), Positives = 36/36 (100%) Frame = -2 Query: 318 GLPTLFFVSPDPKKEAIRTEGLIPIQMMRDIIDKEM 211 GLPTLFF+SPDPKK+AIRTEGLIPIQMMRDIIDK+M Sbjct: 153 GLPTLFFISPDPKKDAIRTEGLIPIQMMRDIIDKDM 188 >ref|XP_019456520.1| PREDICTED: thioredoxin-like protein CITRX2, chloroplastic [Lupinus angustifolius] gb|OIW04872.1| hypothetical protein TanjilG_14303 [Lupinus angustifolius] Length = 183 Score = 72.0 bits (175), Expect = 2e-13 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = -2 Query: 318 GLPTLFFVSPDPKKEAIRTEGLIPIQMMRDIIDKEM 211 GLPTLFF+SPDP K+AIRTEGLIPIQMMRDIIDKEM Sbjct: 148 GLPTLFFISPDPNKDAIRTEGLIPIQMMRDIIDKEM 183 >ref|XP_004146769.1| PREDICTED: thioredoxin-like protein CITRX, chloroplastic [Cucumis sativus] gb|KGN47767.1| hypothetical protein Csa_6G401380 [Cucumis sativus] Length = 183 Score = 72.0 bits (175), Expect = 2e-13 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = -2 Query: 318 GLPTLFFVSPDPKKEAIRTEGLIPIQMMRDIIDKEM 211 GLPTLFF+SPDP KEAIRTEGLIPIQMMRDIID+EM Sbjct: 148 GLPTLFFISPDPNKEAIRTEGLIPIQMMRDIIDREM 183 >ref|XP_013644008.1| thioredoxin-like protein CITRX, chloroplastic [Brassica napus] Length = 76 Score = 68.9 bits (167), Expect = 3e-13 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = -2 Query: 318 GLPTLFFVSPDPKKEAIRTEGLIPIQMMRDIIDKEM 211 GLPTLFF+SPDP K+AIRTEGLIPIQMMRDIID +M Sbjct: 41 GLPTLFFISPDPSKDAIRTEGLIPIQMMRDIIDNDM 76 >ref|XP_013466891.1| thioredoxin-like protein [Medicago truncatula] gb|KEH40932.1| thioredoxin-like protein [Medicago truncatula] Length = 186 Score = 71.6 bits (174), Expect = 3e-13 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = -2 Query: 318 GLPTLFFVSPDPKKEAIRTEGLIPIQMMRDIIDKEM 211 GLPTL F+SPDPKK+AIRTEGLIPIQMMRDIIDKEM Sbjct: 151 GLPTLLFISPDPKKDAIRTEGLIPIQMMRDIIDKEM 186 >ref|XP_008445409.1| PREDICTED: thioredoxin-like protein CITRX, chloroplastic [Cucumis melo] Length = 177 Score = 71.2 bits (173), Expect = 4e-13 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -2 Query: 318 GLPTLFFVSPDPKKEAIRTEGLIPIQMMRDIIDKEM 211 GLPTLFF+SPDP KEAIRTEGLIPIQMMRDIID EM Sbjct: 142 GLPTLFFISPDPNKEAIRTEGLIPIQMMRDIIDNEM 177 >gb|EOY19739.1| Thioredoxin z, P,TRX z isoform 2 [Theobroma cacao] Length = 146 Score = 70.5 bits (171), Expect = 4e-13 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = -2 Query: 318 GLPTLFFVSPDPKKEAIRTEGLIPIQMMRDIIDKEM 211 GLPTLFF+SPDP KEAIRTEGLIPIQMMRDI+D EM Sbjct: 111 GLPTLFFISPDPNKEAIRTEGLIPIQMMRDILDNEM 146 >ref|XP_021888350.1| thioredoxin-like protein CITRX, chloroplastic [Carica papaya] Length = 181 Score = 70.9 bits (172), Expect = 6e-13 Identities = 32/36 (88%), Positives = 35/36 (97%) Frame = -2 Query: 318 GLPTLFFVSPDPKKEAIRTEGLIPIQMMRDIIDKEM 211 GLPTLFF+SPDP K+AIRTEGLIPIQMMRDI+DKEM Sbjct: 146 GLPTLFFISPDPTKDAIRTEGLIPIQMMRDILDKEM 181 >gb|KFK38136.1| hypothetical protein AALP_AA3G074300 [Arabis alpina] Length = 183 Score = 70.9 bits (172), Expect = 6e-13 Identities = 32/36 (88%), Positives = 35/36 (97%) Frame = -2 Query: 318 GLPTLFFVSPDPKKEAIRTEGLIPIQMMRDIIDKEM 211 GLPTLFF+SPDP K+AIRTEGLIPIQMMRDIIDK+M Sbjct: 148 GLPTLFFISPDPNKDAIRTEGLIPIQMMRDIIDKDM 183 >gb|AFK49499.1| unknown [Lotus japonicus] Length = 188 Score = 70.9 bits (172), Expect = 7e-13 Identities = 32/36 (88%), Positives = 35/36 (97%) Frame = -2 Query: 318 GLPTLFFVSPDPKKEAIRTEGLIPIQMMRDIIDKEM 211 GLPT+FF+SPDP K+AIRTEGLIPIQMMRDIIDKEM Sbjct: 153 GLPTVFFISPDPNKDAIRTEGLIPIQMMRDIIDKEM 188 >gb|AFK47218.1| unknown [Lotus japonicus] Length = 188 Score = 70.9 bits (172), Expect = 7e-13 Identities = 32/36 (88%), Positives = 35/36 (97%) Frame = -2 Query: 318 GLPTLFFVSPDPKKEAIRTEGLIPIQMMRDIIDKEM 211 GLPT+FF+SPDP K+AIRTEGLIPIQMMRDIIDKEM Sbjct: 153 GLPTVFFISPDPNKDAIRTEGLIPIQMMRDIIDKEM 188 >ref|XP_015570810.1| PREDICTED: thioredoxin-like protein CITRX, chloroplastic [Ricinus communis] Length = 189 Score = 70.9 bits (172), Expect = 7e-13 Identities = 32/36 (88%), Positives = 35/36 (97%) Frame = -2 Query: 318 GLPTLFFVSPDPKKEAIRTEGLIPIQMMRDIIDKEM 211 GLPT+FF+SPDP K+AIRTEGLIPIQMMRDIIDKEM Sbjct: 154 GLPTVFFISPDPNKDAIRTEGLIPIQMMRDIIDKEM 189