BLASTX nr result
ID: Astragalus23_contig00025436
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus23_contig00025436 (335 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_014621764.1| PREDICTED: U-box domain-containing protein 2... 55 3e-06 ref|XP_020236607.1| U-box domain-containing protein 26-like isof... 53 1e-05 >ref|XP_014621764.1| PREDICTED: U-box domain-containing protein 26 isoform X2 [Glycine max] Length = 447 Score = 54.7 bits (130), Expect = 3e-06 Identities = 28/39 (71%), Positives = 31/39 (79%), Gaps = 2/39 (5%) Frame = -1 Query: 179 MWESCG--YWVERKTFTDSLAFGEVHVSDSSMDGSVFDF 69 MW++CG YWVERK SL FGEVHVS SS+DGSVFDF Sbjct: 407 MWKACGFIYWVERK---HSLPFGEVHVSVSSIDGSVFDF 442 >ref|XP_020236607.1| U-box domain-containing protein 26-like isoform X2 [Cajanus cajan] Length = 453 Score = 53.1 bits (126), Expect = 1e-05 Identities = 30/48 (62%), Positives = 34/48 (70%) Frame = -1 Query: 209 FGVCFVNLICMWESCGYWVERKTFTDSLAFGEVHVSDSSMDGSVFDFK 66 FG+ FVNL+ YWVERK SL FGEVHVS SS+DGSVFDF+ Sbjct: 406 FGL-FVNLLACGNLVVYWVERK---HSLPFGEVHVSVSSIDGSVFDFR 449