BLASTX nr result
ID: Astragalus23_contig00025345
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus23_contig00025345 (312 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AGI60285.2| soluble starch synthase II, partial [Nicotiana ta... 64 4e-11 gb|ABK91036.1| putative starch synthase IIa, partial [Sorghum bi... 63 2e-10 gb|AEO14362.1| starch synthase IIa, partial [Sorghum bicolor] >g... 63 2e-10 gb|ACL98482.1| starch synthase IIb precursor [Lotus japonicus] 66 2e-10 ref|XP_010693244.1| PREDICTED: granule-bound starch synthase 2, ... 66 2e-10 gb|ABN48659.1| starch synthase II, partial [Triticum aestivum] 64 5e-10 ref|XP_016194288.1| granule-bound starch synthase 2, chloroplast... 65 5e-10 gb|PNS95882.1| hypothetical protein POPTR_017G084100v3 [Populus ... 65 6e-10 ref|XP_015962756.1| granule-bound starch synthase 2, chloroplast... 65 7e-10 gb|PNS95883.1| hypothetical protein POPTR_017G084100v3 [Populus ... 65 7e-10 ref|XP_002324061.2| glycogen synthase family protein [Populus tr... 65 7e-10 gb|PNS95884.1| hypothetical protein POPTR_017G084100v3 [Populus ... 65 7e-10 ref|XP_018813997.1| PREDICTED: granule-bound starch synthase 2, ... 65 7e-10 ref|XP_021911182.1| starch synthase 2, chloroplastic/amyloplasti... 64 9e-10 dbj|GAV58083.1| Glycos_transf_1 domain-containing protein/Glyco_... 64 1e-09 ref|XP_017235948.1| PREDICTED: granule-bound starch synthase 2, ... 64 1e-09 ref|XP_011035764.1| PREDICTED: granule-bound starch synthase 2, ... 64 1e-09 ref|XP_011035763.1| PREDICTED: granule-bound starch synthase 2, ... 64 1e-09 gb|OIW21160.1| hypothetical protein TanjilG_29934 [Lupinus angus... 64 1e-09 ref|XP_019432439.1| PREDICTED: granule-bound starch synthase 2, ... 64 1e-09 >gb|AGI60285.2| soluble starch synthase II, partial [Nicotiana tabacum] Length = 76 Score = 63.5 bits (153), Expect = 4e-11 Identities = 28/42 (66%), Positives = 30/42 (71%) Frame = +2 Query: 185 WHVSGGGIDYGDGNLVFTTNDWKTTLLPVDLKAYYPDQELAK 310 WHV GG+ YGDGNLVF NDW T LLPV LKAYY D + K Sbjct: 3 WHVPCGGVCYGDGNLVFIANDWHTALLPVYLKAYYRDNGMMK 44 >gb|ABK91036.1| putative starch synthase IIa, partial [Sorghum bicolor] gb|ABK91037.1| putative starch synthase IIa, partial [Sorghum bicolor] gb|ABK91038.1| putative starch synthase IIa, partial [Sorghum bicolor] gb|ABK91039.1| putative starch synthase IIa, partial [Sorghum bicolor] gb|ABK91040.1| putative starch synthase IIa, partial [Sorghum bicolor] gb|ABK91041.1| putative starch synthase IIa, partial [Sorghum bicolor] gb|ABK91042.1| putative starch synthase IIa, partial [Sorghum bicolor] gb|ABK91043.1| putative starch synthase IIa, partial [Sorghum bicolor] gb|ABK91044.1| putative starch synthase IIa, partial [Sorghum bicolor] gb|ABK91045.1| putative starch synthase IIa, partial [Sorghum bicolor] gb|ABK91046.1| putative starch synthase IIa, partial [Sorghum bicolor] gb|ABK91047.1| putative starch synthase IIa, partial [Sorghum bicolor] gb|ABK91048.1| putative starch synthase IIa, partial [Sorghum bicolor] gb|ABK91049.1| putative starch synthase IIa, partial [Sorghum bicolor] gb|ABK91050.1| putative starch synthase IIa, partial [Sorghum bicolor] gb|ABK91051.1| putative starch synthase IIa, partial [Sorghum bicolor] gb|ABK91052.1| putative starch synthase IIa, partial [Sorghum bicolor] gb|ABK91053.1| putative starch synthase IIa, partial [Sorghum bicolor] gb|ABK91054.1| putative starch synthase IIa, partial [Sorghum bicolor] gb|ABK91055.1| putative starch synthase IIa, partial [Sorghum bicolor] gb|ABK91056.1| putative starch synthase IIa, partial [Sorghum bicolor] gb|ABK91057.1| putative starch synthase IIa, partial [Sorghum bicolor] gb|ABK91058.1| putative starch synthase IIa, partial [Sorghum bicolor] Length = 106 Score = 62.8 bits (151), Expect = 2e-10 Identities = 28/40 (70%), Positives = 29/40 (72%) Frame = +2 Query: 185 WHVSGGGIDYGDGNLVFTTNDWKTTLLPVDLKAYYPDQEL 304 WHV GG+ YGDGNLVF NDW T LLPV LKAYY D L Sbjct: 51 WHVPCGGVCYGDGNLVFIANDWHTALLPVYLKAYYRDHGL 90 >gb|AEO14362.1| starch synthase IIa, partial [Sorghum bicolor] gb|AEO14363.1| starch synthase IIa, partial [Sorghum bicolor] gb|AEO14364.1| starch synthase IIa, partial [Sorghum bicolor] gb|AEO14365.1| starch synthase IIa, partial [Sorghum bicolor] gb|AEO14366.1| starch synthase IIa, partial [Sorghum bicolor] gb|AEO14367.1| starch synthase IIa, partial [Sorghum bicolor] gb|AEO14368.1| starch synthase IIa, partial [Sorghum bicolor] gb|AEO14369.1| starch synthase IIa, partial [Sorghum bicolor] gb|AEO14370.1| starch synthase IIa, partial [Sorghum bicolor] gb|AEO14371.1| starch synthase IIa, partial [Sorghum bicolor] gb|AEO14372.1| starch synthase IIa, partial [Sorghum bicolor] gb|AEO14373.1| starch synthase IIa, partial [Sorghum bicolor] gb|AEO14374.1| starch synthase IIa, partial [Sorghum bicolor] gb|AEO14375.1| starch synthase IIa, partial [Sorghum bicolor] gb|AEO14376.1| starch synthase IIa, partial [Sorghum bicolor] gb|AEO14377.1| starch synthase IIa, partial [Sorghum bicolor] gb|AEO14378.1| starch synthase IIa, partial [Sorghum bicolor] gb|AEO14379.1| starch synthase IIa, partial [Sorghum bicolor] gb|AEO14380.1| starch synthase IIa, partial [Sorghum bicolor] gb|AEO14381.1| starch synthase IIa, partial [Sorghum bicolor] gb|AEO14382.1| starch synthase IIa, partial [Sorghum bicolor] gb|AEO14383.1| starch synthase IIa, partial [Sorghum bicolor] gb|AEO14384.1| starch synthase IIa, partial [Sorghum bicolor] gb|AEO14385.1| starch synthase IIa, partial [Sorghum bicolor] gb|AEO14386.1| starch synthase IIa, partial [Sorghum bicolor] gb|AEO14387.1| starch synthase IIa, partial [Sorghum bicolor] gb|AEO14388.1| starch synthase IIa, partial [Sorghum bicolor] gb|AEO14389.1| starch synthase IIa, partial [Sorghum bicolor] gb|AEO14390.1| starch synthase IIa, partial [Sorghum bicolor] gb|AEO14391.1| starch synthase IIa, partial [Sorghum bicolor] gb|AEO14392.1| starch synthase IIa, partial [Sorghum bicolor] gb|AEO14393.1| starch synthase IIa, partial [Sorghum bicolor] gb|AEO14394.1| starch synthase IIa, partial [Sorghum bicolor] gb|AEO14395.1| starch synthase IIa, partial [Sorghum bicolor] gb|AEO14396.1| starch synthase IIa, partial [Sorghum bicolor] Length = 117 Score = 62.8 bits (151), Expect = 2e-10 Identities = 28/40 (70%), Positives = 29/40 (72%) Frame = +2 Query: 185 WHVSGGGIDYGDGNLVFTTNDWKTTLLPVDLKAYYPDQEL 304 WHV GG+ YGDGNLVF NDW T LLPV LKAYY D L Sbjct: 55 WHVPCGGVCYGDGNLVFIANDWHTALLPVYLKAYYRDHGL 94 >gb|ACL98482.1| starch synthase IIb precursor [Lotus japonicus] Length = 800 Score = 66.2 bits (160), Expect = 2e-10 Identities = 30/42 (71%), Positives = 31/42 (73%) Frame = +2 Query: 185 WHVSGGGIDYGDGNLVFTTNDWKTTLLPVDLKAYYPDQELAK 310 WHV GG+ YGDGNLVF NDW T LLPV LKAYY DQ L K Sbjct: 427 WHVPCGGVCYGDGNLVFIANDWHTALLPVYLKAYYRDQGLMK 468 >ref|XP_010693244.1| PREDICTED: granule-bound starch synthase 2, chloroplastic/amyloplastic [Beta vulgaris subsp. vulgaris] ref|XP_010693245.1| PREDICTED: granule-bound starch synthase 2, chloroplastic/amyloplastic [Beta vulgaris subsp. vulgaris] gb|KMS99236.1| hypothetical protein BVRB_2g046740 [Beta vulgaris subsp. vulgaris] Length = 801 Score = 66.2 bits (160), Expect = 2e-10 Identities = 30/42 (71%), Positives = 31/42 (73%) Frame = +2 Query: 185 WHVSGGGIDYGDGNLVFTTNDWKTTLLPVDLKAYYPDQELAK 310 WHV GG+ YGDGNLVF NDW T LLPV LKAYY DQ L K Sbjct: 428 WHVPCGGVCYGDGNLVFIANDWHTALLPVYLKAYYRDQGLMK 469 >gb|ABN48659.1| starch synthase II, partial [Triticum aestivum] Length = 199 Score = 63.5 bits (153), Expect = 5e-10 Identities = 28/40 (70%), Positives = 29/40 (72%) Frame = +2 Query: 185 WHVSGGGIDYGDGNLVFTTNDWKTTLLPVDLKAYYPDQEL 304 WHV GG+ YGDGNLVF NDW T LLPV LKAYY D L Sbjct: 71 WHVPCGGVPYGDGNLVFIANDWHTALLPVYLKAYYRDHGL 110 >ref|XP_016194288.1| granule-bound starch synthase 2, chloroplastic/amyloplastic [Arachis ipaensis] Length = 724 Score = 65.1 bits (157), Expect = 5e-10 Identities = 29/42 (69%), Positives = 31/42 (73%) Frame = +2 Query: 185 WHVSGGGIDYGDGNLVFTTNDWKTTLLPVDLKAYYPDQELAK 310 WHV GG+ YGDGNL F NDW T+LLPV LKAYY DQ L K Sbjct: 351 WHVPCGGVCYGDGNLAFIANDWHTSLLPVYLKAYYRDQGLMK 392 >gb|PNS95882.1| hypothetical protein POPTR_017G084100v3 [Populus trichocarpa] Length = 394 Score = 64.7 bits (156), Expect = 6e-10 Identities = 30/42 (71%), Positives = 30/42 (71%) Frame = +2 Query: 185 WHVSGGGIDYGDGNLVFTTNDWKTTLLPVDLKAYYPDQELAK 310 WHV GGI YGDGNLVF NDW T LLPV LKAYY D L K Sbjct: 21 WHVPCGGICYGDGNLVFIANDWHTALLPVYLKAYYRDNGLMK 62 >ref|XP_015962756.1| granule-bound starch synthase 2, chloroplastic/amyloplastic [Arachis duranensis] Length = 721 Score = 64.7 bits (156), Expect = 7e-10 Identities = 28/42 (66%), Positives = 31/42 (73%) Frame = +2 Query: 185 WHVSGGGIDYGDGNLVFTTNDWKTTLLPVDLKAYYPDQELAK 310 WH+ GG+ YGDGNL F NDW T+LLPV LKAYY DQ L K Sbjct: 348 WHIPCGGVCYGDGNLAFIANDWHTSLLPVYLKAYYRDQGLMK 389 >gb|PNS95883.1| hypothetical protein POPTR_017G084100v3 [Populus trichocarpa] Length = 742 Score = 64.7 bits (156), Expect = 7e-10 Identities = 30/42 (71%), Positives = 30/42 (71%) Frame = +2 Query: 185 WHVSGGGIDYGDGNLVFTTNDWKTTLLPVDLKAYYPDQELAK 310 WHV GGI YGDGNLVF NDW T LLPV LKAYY D L K Sbjct: 369 WHVPCGGICYGDGNLVFIANDWHTALLPVYLKAYYRDNGLMK 410 >ref|XP_002324061.2| glycogen synthase family protein [Populus trichocarpa] Length = 742 Score = 64.7 bits (156), Expect = 7e-10 Identities = 30/42 (71%), Positives = 30/42 (71%) Frame = +2 Query: 185 WHVSGGGIDYGDGNLVFTTNDWKTTLLPVDLKAYYPDQELAK 310 WHV GGI YGDGNLVF NDW T LLPV LKAYY D L K Sbjct: 369 WHVPCGGICYGDGNLVFIANDWHTALLPVYLKAYYRDNGLMK 410 >gb|PNS95884.1| hypothetical protein POPTR_017G084100v3 [Populus trichocarpa] Length = 755 Score = 64.7 bits (156), Expect = 7e-10 Identities = 30/42 (71%), Positives = 30/42 (71%) Frame = +2 Query: 185 WHVSGGGIDYGDGNLVFTTNDWKTTLLPVDLKAYYPDQELAK 310 WHV GGI YGDGNLVF NDW T LLPV LKAYY D L K Sbjct: 382 WHVPCGGICYGDGNLVFIANDWHTALLPVYLKAYYRDNGLMK 423 >ref|XP_018813997.1| PREDICTED: granule-bound starch synthase 2, chloroplastic/amyloplastic-like [Juglans regia] Length = 780 Score = 64.7 bits (156), Expect = 7e-10 Identities = 30/42 (71%), Positives = 30/42 (71%) Frame = +2 Query: 185 WHVSGGGIDYGDGNLVFTTNDWKTTLLPVDLKAYYPDQELAK 310 WHV GGI YGDGNLVF NDW T LLPV LKAYY D L K Sbjct: 407 WHVPCGGICYGDGNLVFIANDWHTALLPVYLKAYYRDHGLMK 448 >ref|XP_021911182.1| starch synthase 2, chloroplastic/amyloplastic-like [Carica papaya] Length = 381 Score = 64.3 bits (155), Expect = 9e-10 Identities = 29/42 (69%), Positives = 30/42 (71%) Frame = +2 Query: 185 WHVSGGGIDYGDGNLVFTTNDWKTTLLPVDLKAYYPDQELAK 310 WHV GG+ YGDGNLVF NDW T LLPV LKAYY D L K Sbjct: 8 WHVPCGGVCYGDGNLVFIANDWHTALLPVYLKAYYRDHGLMK 49 >dbj|GAV58083.1| Glycos_transf_1 domain-containing protein/Glyco_transf_5 domain-containing protein [Cephalotus follicularis] Length = 724 Score = 64.3 bits (155), Expect = 1e-09 Identities = 29/42 (69%), Positives = 30/42 (71%) Frame = +2 Query: 185 WHVSGGGIDYGDGNLVFTTNDWKTTLLPVDLKAYYPDQELAK 310 WHV GG+ YGDGNLVF NDW T LLPV LKAYY D L K Sbjct: 351 WHVPCGGVCYGDGNLVFIANDWHTALLPVYLKAYYRDNGLMK 392 >ref|XP_017235948.1| PREDICTED: granule-bound starch synthase 2, chloroplastic/amyloplastic [Daucus carota subsp. sativus] gb|KZN04725.1| hypothetical protein DCAR_005562 [Daucus carota subsp. sativus] Length = 731 Score = 64.3 bits (155), Expect = 1e-09 Identities = 29/42 (69%), Positives = 30/42 (71%) Frame = +2 Query: 185 WHVSGGGIDYGDGNLVFTTNDWKTTLLPVDLKAYYPDQELAK 310 WHV GG+ YGDGNLVF NDW T LLPV LKAYY D L K Sbjct: 358 WHVPCGGVCYGDGNLVFIANDWHTALLPVYLKAYYRDNGLMK 399 >ref|XP_011035764.1| PREDICTED: granule-bound starch synthase 2, chloroplastic/amyloplastic isoform X2 [Populus euphratica] Length = 740 Score = 64.3 bits (155), Expect = 1e-09 Identities = 29/42 (69%), Positives = 30/42 (71%) Frame = +2 Query: 185 WHVSGGGIDYGDGNLVFTTNDWKTTLLPVDLKAYYPDQELAK 310 WHV GG+ YGDGNLVF NDW T LLPV LKAYY D L K Sbjct: 367 WHVPCGGVCYGDGNLVFIANDWHTALLPVYLKAYYRDNGLMK 408 >ref|XP_011035763.1| PREDICTED: granule-bound starch synthase 2, chloroplastic/amyloplastic isoform X1 [Populus euphratica] Length = 755 Score = 64.3 bits (155), Expect = 1e-09 Identities = 29/42 (69%), Positives = 30/42 (71%) Frame = +2 Query: 185 WHVSGGGIDYGDGNLVFTTNDWKTTLLPVDLKAYYPDQELAK 310 WHV GG+ YGDGNLVF NDW T LLPV LKAYY D L K Sbjct: 382 WHVPCGGVCYGDGNLVFIANDWHTALLPVYLKAYYRDNGLMK 423 >gb|OIW21160.1| hypothetical protein TanjilG_29934 [Lupinus angustifolius] Length = 773 Score = 64.3 bits (155), Expect = 1e-09 Identities = 29/42 (69%), Positives = 30/42 (71%) Frame = +2 Query: 185 WHVSGGGIDYGDGNLVFTTNDWKTTLLPVDLKAYYPDQELAK 310 WHV GG+ YGDGNLVF NDW T LLPV LKAYY D L K Sbjct: 400 WHVPCGGVCYGDGNLVFIANDWHTALLPVYLKAYYRDHGLMK 441 >ref|XP_019432439.1| PREDICTED: granule-bound starch synthase 2, chloroplastic/amyloplastic-like [Lupinus angustifolius] Length = 776 Score = 64.3 bits (155), Expect = 1e-09 Identities = 29/42 (69%), Positives = 30/42 (71%) Frame = +2 Query: 185 WHVSGGGIDYGDGNLVFTTNDWKTTLLPVDLKAYYPDQELAK 310 WHV GG+ YGDGNLVF NDW T LLPV LKAYY D L K Sbjct: 403 WHVPCGGVCYGDGNLVFIANDWHTALLPVYLKAYYRDHGLMK 444