BLASTX nr result
ID: Astragalus23_contig00025326
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus23_contig00025326 (688 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007158272.1| hypothetical protein PHAVU_002G138600g [Phas... 79 2e-13 ref|XP_014519698.1| pentatricopeptide repeat-containing protein ... 79 3e-13 ref|XP_020203084.1| pentatricopeptide repeat-containing protein ... 76 3e-12 ref|XP_014622319.1| PREDICTED: pentatricopeptide repeat-containi... 72 6e-11 gb|KHN04861.1| Pentatricopeptide repeat-containing protein, mito... 70 3e-10 ref|XP_017426117.1| PREDICTED: pentatricopeptide repeat-containi... 70 3e-10 gb|OIV97404.1| hypothetical protein TanjilG_16165 [Lupinus angus... 67 3e-09 ref|XP_019417494.1| PREDICTED: pentatricopeptide repeat-containi... 67 3e-09 emb|CDP11808.1| unnamed protein product [Coffea canephora] 62 2e-07 ref|XP_013624367.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 59 2e-06 ref|XP_021974003.1| putative pentatricopeptide repeat-containing... 59 3e-06 gb|KZV53841.1| pentatricopeptide repeat-containing protein mitoc... 58 4e-06 ref|XP_004145716.1| PREDICTED: pentatricopeptide repeat-containi... 58 5e-06 ref|XP_017178041.1| PREDICTED: pentatricopeptide repeat-containi... 58 5e-06 ref|XP_008392359.1| PREDICTED: pentatricopeptide repeat-containi... 58 5e-06 ref|XP_006413978.1| pentatricopeptide repeat-containing protein ... 58 5e-06 ref|XP_007153169.1| hypothetical protein PHAVU_003G012700g [Phas... 57 7e-06 ref|XP_022845009.1| putative pentatricopeptide repeat-containing... 57 7e-06 ref|XP_011099772.1| pentatricopeptide repeat-containing protein ... 57 9e-06 ref|XP_011099771.1| pentatricopeptide repeat-containing protein ... 57 9e-06 >ref|XP_007158272.1| hypothetical protein PHAVU_002G138600g [Phaseolus vulgaris] gb|ESW30266.1| hypothetical protein PHAVU_002G138600g [Phaseolus vulgaris] Length = 831 Score = 79.3 bits (194), Expect = 2e-13 Identities = 42/84 (50%), Positives = 55/84 (65%), Gaps = 2/84 (2%) Frame = -2 Query: 684 CKLDPEVDSNSISWLFDLFHKMHKNPYIPDFVTYTVLITCYLKQGSIVQALKLYNKMKEN 505 C +D SN I LF +M+++ IP+ TYTVLI Y + G QA KLY+ MKEN Sbjct: 722 CMIDGFCKSNRIDLATRLFDEMNRDSVIPNVATYTVLIAWYHRHGYTDQAHKLYDIMKEN 781 Query: 504 GILPDDLTRKVLGL--EFVKKRKI 439 G+LPDD+TRKVLG+ +F K RK+ Sbjct: 782 GVLPDDITRKVLGMNVQFTKSRKL 805 Score = 64.3 bits (155), Expect = 3e-08 Identities = 37/82 (45%), Positives = 46/82 (56%) Frame = -2 Query: 684 CKLDPEVDSNSISWLFDLFHKMHKNPYIPDFVTYTVLITCYLKQGSIVQALKLYNKMKEN 505 C +D SN I LF KM+++ IPD TYTVLI Y K G I +A KLY+ MKE Sbjct: 652 CMIDGFCKSNRIDLATWLFDKMNRDSVIPDVATYTVLIAWYHKHGYIDEAHKLYDIMKEK 711 Query: 504 GILPDDLTRKVLGLEFVKKRKI 439 G+LPD T + F K +I Sbjct: 712 GVLPDVFTYTCMIDGFCKSNRI 733 >ref|XP_014519698.1| pentatricopeptide repeat-containing protein At1g63130, mitochondrial [Vigna radiata var. radiata] ref|XP_022643210.1| pentatricopeptide repeat-containing protein At1g63130, mitochondrial [Vigna radiata var. radiata] ref|XP_022643211.1| pentatricopeptide repeat-containing protein At1g63130, mitochondrial [Vigna radiata var. radiata] ref|XP_022643212.1| pentatricopeptide repeat-containing protein At1g63130, mitochondrial [Vigna radiata var. radiata] ref|XP_022643213.1| pentatricopeptide repeat-containing protein At1g63130, mitochondrial [Vigna radiata var. radiata] Length = 767 Score = 79.0 bits (193), Expect = 3e-13 Identities = 39/78 (50%), Positives = 50/78 (64%) Frame = -2 Query: 684 CKLDPEVDSNSISWLFDLFHKMHKNPYIPDFVTYTVLITCYLKQGSIVQALKLYNKMKEN 505 C +D SN I + LFH+M++ IPD TYTVLI Y K G I QA KLY++MKE Sbjct: 686 CMIDGFCKSNRIYFATSLFHEMNRYSVIPDVATYTVLIAWYHKHGDIGQAQKLYDEMKEK 745 Query: 504 GILPDDLTRKVLGLEFVK 451 G+LPDD+ +LGL+ K Sbjct: 746 GVLPDDIIHNILGLKACK 763 >ref|XP_020203084.1| pentatricopeptide repeat-containing protein At1g63330-like [Cajanus cajan] ref|XP_020203085.1| pentatricopeptide repeat-containing protein At1g63330-like [Cajanus cajan] ref|XP_020203086.1| pentatricopeptide repeat-containing protein At1g63330-like [Cajanus cajan] ref|XP_020203087.1| pentatricopeptide repeat-containing protein At1g63330-like [Cajanus cajan] ref|XP_020203088.1| pentatricopeptide repeat-containing protein At1g63330-like [Cajanus cajan] ref|XP_020203089.1| pentatricopeptide repeat-containing protein At1g63330-like [Cajanus cajan] gb|KYP39447.1| hypothetical protein KK1_039226 [Cajanus cajan] Length = 732 Score = 76.3 bits (186), Expect = 3e-12 Identities = 40/75 (53%), Positives = 49/75 (65%) Frame = -2 Query: 684 CKLDPEVDSNSISWLFDLFHKMHKNPYIPDFVTYTVLITCYLKQGSIVQALKLYNKMKEN 505 C +D SN I LF KM+++ IPD VTYTVLI Y K G I QA KLY++MK Sbjct: 651 CLIDGFCKSNRIDLATWLFDKMNRDSVIPDVVTYTVLIAWYHKHGYIDQAYKLYDEMKAK 710 Query: 504 GILPDDLTRKVLGLE 460 G+LPDD+T VLGL+ Sbjct: 711 GVLPDDITHMVLGLK 725 >ref|XP_014622319.1| PREDICTED: pentatricopeptide repeat-containing protein At1g12300, mitochondrial-like [Glycine max] ref|XP_014622332.1| PREDICTED: pentatricopeptide repeat-containing protein At1g12300, mitochondrial-like [Glycine max] ref|XP_014622345.1| PREDICTED: pentatricopeptide repeat-containing protein At1g12300, mitochondrial-like [Glycine max] ref|XP_014622357.1| PREDICTED: pentatricopeptide repeat-containing protein At1g12300, mitochondrial-like [Glycine max] ref|XP_014622368.1| PREDICTED: pentatricopeptide repeat-containing protein At1g12300, mitochondrial-like [Glycine max] gb|KRH74389.1| hypothetical protein GLYMA_01G016100 [Glycine max] Length = 734 Score = 72.4 bits (176), Expect = 6e-11 Identities = 38/75 (50%), Positives = 48/75 (64%) Frame = -2 Query: 684 CKLDPEVDSNSISWLFDLFHKMHKNPYIPDFVTYTVLITCYLKQGSIVQALKLYNKMKEN 505 C +D SN I +F KM+++ IPD VTYTVLI Y K G QA KLY+ MK+ Sbjct: 653 CIIDGFCKSNRIDLATWVFDKMNRDSVIPDVVTYTVLIDWYHKHGYFDQAHKLYDVMKDK 712 Query: 504 GILPDDLTRKVLGLE 460 G+LPDD+T VLGL+ Sbjct: 713 GVLPDDITHNVLGLK 727 >gb|KHN04861.1| Pentatricopeptide repeat-containing protein, mitochondrial [Glycine soja] Length = 566 Score = 70.1 bits (170), Expect = 3e-10 Identities = 37/75 (49%), Positives = 47/75 (62%) Frame = -2 Query: 684 CKLDPEVDSNSISWLFDLFHKMHKNPYIPDFVTYTVLITCYLKQGSIVQALKLYNKMKEN 505 C +D SN I +F KM+++ IPD VTYTVLI Y K G QA KLY+ MK+ Sbjct: 485 CIIDGFCKSNRIDLATWVFDKMNRDSVIPDVVTYTVLIDWYHKHGYFDQAHKLYDVMKDK 544 Query: 504 GILPDDLTRKVLGLE 460 G+LPDD+ VLGL+ Sbjct: 545 GVLPDDIIHNVLGLK 559 >ref|XP_017426117.1| PREDICTED: pentatricopeptide repeat-containing protein At3g22470, mitochondrial-like [Vigna angularis] ref|XP_017426118.1| PREDICTED: pentatricopeptide repeat-containing protein At3g22470, mitochondrial-like [Vigna angularis] gb|KOM45539.1| hypothetical protein LR48_Vigan06g084500 [Vigna angularis] dbj|BAU03138.1| hypothetical protein VIGAN_UM017900 [Vigna angularis var. angularis] Length = 732 Score = 70.1 bits (170), Expect = 3e-10 Identities = 37/78 (47%), Positives = 47/78 (60%) Frame = -2 Query: 684 CKLDPEVDSNSISWLFDLFHKMHKNPYIPDFVTYTVLITCYLKQGSIVQALKLYNKMKEN 505 C +D SN I LF +M++ IPD TY+VLI Y K G I QA KLY+ MKE Sbjct: 651 CMIDGFCKSNRIDLATWLFDEMNRASVIPDVATYSVLIAWYHKHGHIGQAQKLYDVMKEK 710 Query: 504 GILPDDLTRKVLGLEFVK 451 G+LPDD+ +LGL+ K Sbjct: 711 GVLPDDIIHNILGLKASK 728 >gb|OIV97404.1| hypothetical protein TanjilG_16165 [Lupinus angustifolius] Length = 622 Score = 67.4 bits (163), Expect = 3e-09 Identities = 35/75 (46%), Positives = 47/75 (62%) Frame = -2 Query: 684 CKLDPEVDSNSISWLFDLFHKMHKNPYIPDFVTYTVLITCYLKQGSIVQALKLYNKMKEN 505 C +D SN I LF +M+++ PD VTYTVLI+ Y K + QA +LY++MK Sbjct: 541 CLIDGFCKSNRIDLASSLFDQMNRDAVTPDVVTYTVLISWYHKHACVDQAHRLYDEMKAK 600 Query: 504 GILPDDLTRKVLGLE 460 GILPD T +VLGL+ Sbjct: 601 GILPDARTHEVLGLQ 615 >ref|XP_019417494.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710-like [Lupinus angustifolius] ref|XP_019417495.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710-like [Lupinus angustifolius] ref|XP_019417496.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710-like [Lupinus angustifolius] ref|XP_019417497.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710-like [Lupinus angustifolius] Length = 744 Score = 67.4 bits (163), Expect = 3e-09 Identities = 35/75 (46%), Positives = 47/75 (62%) Frame = -2 Query: 684 CKLDPEVDSNSISWLFDLFHKMHKNPYIPDFVTYTVLITCYLKQGSIVQALKLYNKMKEN 505 C +D SN I LF +M+++ PD VTYTVLI+ Y K + QA +LY++MK Sbjct: 663 CLIDGFCKSNRIDLASSLFDQMNRDAVTPDVVTYTVLISWYHKHACVDQAHRLYDEMKAK 722 Query: 504 GILPDDLTRKVLGLE 460 GILPD T +VLGL+ Sbjct: 723 GILPDARTHEVLGLQ 737 >emb|CDP11808.1| unnamed protein product [Coffea canephora] Length = 546 Score = 62.0 bits (149), Expect = 2e-07 Identities = 26/64 (40%), Positives = 45/64 (70%) Frame = -2 Query: 633 LFHKMHKNPYIPDFVTYTVLITCYLKQGSIVQALKLYNKMKENGILPDDLTRKVLGLEFV 454 +FH++H + PD +TYT+L+ + KQG +V A+K+ + M+ENG+ P+D+T V+ F Sbjct: 287 VFHEIHDRGWFPDVMTYTILVDGHCKQGQLVDAIKVMDDMEENGVEPNDVTYGVMIEAFC 346 Query: 453 KKRK 442 K++K Sbjct: 347 KEKK 350 >ref|XP_013624367.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At4g19440, chloroplastic [Brassica oleracea var. oleracea] Length = 770 Score = 58.9 bits (141), Expect = 2e-06 Identities = 29/75 (38%), Positives = 47/75 (62%) Frame = -2 Query: 633 LFHKMHKNPYIPDFVTYTVLITCYLKQGSIVQALKLYNKMKENGILPDDLTRKVLGLEFV 454 L H+MH +P+ TYTV+I Y + G++ +A +L N+M+E GI+PD +T K ++ Sbjct: 679 LLHEMHTKNILPNKNTYTVMIGGYARDGNVTEASRLLNEMREKGIVPDSITYKEFICGYL 738 Query: 453 KKRKILDLEISAIEG 409 K+R +L A+EG Sbjct: 739 KQRGVL----QALEG 749 >ref|XP_021974003.1| putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Helianthus annuus] gb|OTG21380.1| putative tetratricopeptide-like helical domain-containing protein [Helianthus annuus] Length = 573 Score = 58.5 bits (140), Expect = 3e-06 Identities = 29/71 (40%), Positives = 44/71 (61%) Frame = -2 Query: 636 DLFHKMHKNPYIPDFVTYTVLITCYLKQGSIVQALKLYNKMKENGILPDDLTRKVLGLEF 457 DLF ++ PD TYTV+I+ Y ++G V+ +L KM+ENG LPD +T V+ EF Sbjct: 459 DLFDELCLKGLKPDVRTYTVMISVYCQEGLFVEGKELLRKMEENGCLPDSVTYNVIVQEF 518 Query: 456 VKKRKILDLEI 424 +K++ + EI Sbjct: 519 LKQKAFQEAEI 529 >gb|KZV53841.1| pentatricopeptide repeat-containing protein mitochondrial-like [Dorcoceras hygrometricum] Length = 830 Score = 58.2 bits (139), Expect = 4e-06 Identities = 32/81 (39%), Positives = 47/81 (58%) Frame = -2 Query: 678 LDPEVDSNSISWLFDLFHKMHKNPYIPDFVTYTVLITCYLKQGSIVQALKLYNKMKENGI 499 +D + S+S+ LF++M ++ PD VTYT L++ Y KQG I +AL L N+M GI Sbjct: 740 IDCQCKSDSLQGAVSLFNEMIEHGLQPDTVTYTALLSGYCKQGHIGKALTLLNEMSSEGI 799 Query: 498 LPDDLTRKVLGLEFVKKRKIL 436 PD T L V+ +K+L Sbjct: 800 EPDSRTMSTLYNGIVRVKKVL 820 >ref|XP_004145716.1| PREDICTED: pentatricopeptide repeat-containing protein At5g16420, mitochondrial [Cucumis sativus] gb|KGN58196.1| hypothetical protein Csa_3G589540 [Cucumis sativus] Length = 535 Score = 57.8 bits (138), Expect = 5e-06 Identities = 25/64 (39%), Positives = 45/64 (70%) Frame = -2 Query: 633 LFHKMHKNPYIPDFVTYTVLITCYLKQGSIVQALKLYNKMKENGILPDDLTRKVLGLEFV 454 +F ++ + ++PD TYT+L+ Y+KQG A+K+ ++M+ENG+ P+D+T V+ L + Sbjct: 249 VFGELFDHGWLPDATTYTILMDGYVKQGRFTDAVKVMDEMEENGVEPNDITYGVIILGYC 308 Query: 453 KKRK 442 K+RK Sbjct: 309 KERK 312 >ref|XP_017178041.1| PREDICTED: pentatricopeptide repeat-containing protein At1g63400-like isoform X2 [Malus domestica] Length = 671 Score = 57.8 bits (138), Expect = 5e-06 Identities = 29/74 (39%), Positives = 46/74 (62%) Frame = -2 Query: 684 CKLDPEVDSNSISWLFDLFHKMHKNPYIPDFVTYTVLITCYLKQGSIVQALKLYNKMKEN 505 C +D S + + LF +M + IPD VTYTVL+ Y + G+I +A++L+ +MKE Sbjct: 590 CLIDGFCKSLRMDFASFLFDEMKRKNVIPDAVTYTVLMIGYFRLGNIDRAIQLFGEMKER 649 Query: 504 GILPDDLTRKVLGL 463 GI PD + ++ +GL Sbjct: 650 GISPDVIAQETMGL 663 >ref|XP_008392359.1| PREDICTED: pentatricopeptide repeat-containing protein At1g63330-like isoform X1 [Malus domestica] ref|XP_008392360.1| PREDICTED: pentatricopeptide repeat-containing protein At1g63330-like isoform X1 [Malus domestica] ref|XP_008392361.1| PREDICTED: pentatricopeptide repeat-containing protein At1g63330-like isoform X1 [Malus domestica] ref|XP_017178039.1| PREDICTED: pentatricopeptide repeat-containing protein At1g63330-like isoform X1 [Malus domestica] ref|XP_017178040.1| PREDICTED: pentatricopeptide repeat-containing protein At1g63330-like isoform X1 [Malus domestica] Length = 673 Score = 57.8 bits (138), Expect = 5e-06 Identities = 29/74 (39%), Positives = 46/74 (62%) Frame = -2 Query: 684 CKLDPEVDSNSISWLFDLFHKMHKNPYIPDFVTYTVLITCYLKQGSIVQALKLYNKMKEN 505 C +D S + + LF +M + IPD VTYTVL+ Y + G+I +A++L+ +MKE Sbjct: 590 CLIDGFCKSLRMDFASFLFDEMKRKNVIPDAVTYTVLMIGYFRLGNIDRAIQLFGEMKER 649 Query: 504 GILPDDLTRKVLGL 463 GI PD + ++ +GL Sbjct: 650 GISPDVIAQETMGL 663 >ref|XP_006413978.1| pentatricopeptide repeat-containing protein At4g19440, chloroplastic [Eutrema salsugineum] ref|XP_024005842.1| pentatricopeptide repeat-containing protein At4g19440, chloroplastic [Eutrema salsugineum] gb|ESQ55431.1| hypothetical protein EUTSA_v10024401mg [Eutrema salsugineum] Length = 837 Score = 57.8 bits (138), Expect = 5e-06 Identities = 24/66 (36%), Positives = 43/66 (65%) Frame = -2 Query: 633 LFHKMHKNPYIPDFVTYTVLITCYLKQGSIVQALKLYNKMKENGILPDDLTRKVLGLEFV 454 L H+MH +P+ +TYTV+I+ Y + G++ +A +L N+M+E G +PD +T K ++ Sbjct: 749 LLHEMHSKNILPNKITYTVMISGYARDGNVTEASRLLNEMREKGFVPDSITYKEFIYGYL 808 Query: 453 KKRKIL 436 K+ +L Sbjct: 809 KQGGVL 814 >ref|XP_007153169.1| hypothetical protein PHAVU_003G012700g [Phaseolus vulgaris] gb|ESW25163.1| hypothetical protein PHAVU_003G012700g [Phaseolus vulgaris] Length = 767 Score = 57.4 bits (137), Expect = 7e-06 Identities = 27/57 (47%), Positives = 39/57 (68%) Frame = -2 Query: 639 FDLFHKMHKNPYIPDFVTYTVLITCYLKQGSIVQALKLYNKMKENGILPDDLTRKVL 469 FDLF +M + +PD VTYT LI + QG + +AL+L+++M + G LPDD+T VL Sbjct: 517 FDLFREMLQMGLLPDEVTYTSLINAHCAQGELSKALRLHDEMMQRGFLPDDVTYSVL 573 >ref|XP_022845009.1| putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Olea europaea var. sylvestris] ref|XP_022845010.1| putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Olea europaea var. sylvestris] ref|XP_022845011.1| putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Olea europaea var. sylvestris] ref|XP_022845012.1| putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Olea europaea var. sylvestris] ref|XP_022845013.1| putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Olea europaea var. sylvestris] ref|XP_022845014.1| putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Olea europaea var. sylvestris] ref|XP_022845015.1| putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Olea europaea var. sylvestris] ref|XP_022845016.1| putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Olea europaea var. sylvestris] ref|XP_022845018.1| putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Olea europaea var. sylvestris] Length = 801 Score = 57.4 bits (137), Expect = 7e-06 Identities = 31/81 (38%), Positives = 48/81 (59%) Frame = -2 Query: 684 CKLDPEVDSNSISWLFDLFHKMHKNPYIPDFVTYTVLITCYLKQGSIVQALKLYNKMKEN 505 C +D N + + L +M + PD+VTY VLI+ YL+ G + +A KL++KM + Sbjct: 720 CLIDGFCKVNQMVLVNMLVEEMRRENVCPDWVTYLVLISGYLRVGFVDKAHKLFDKMIKE 779 Query: 504 GILPDDLTRKVLGLEFVKKRK 442 G LPDD+T K LGL +++ Sbjct: 780 GGLPDDITIKTLGLTMGSRKE 800 >ref|XP_011099772.1| pentatricopeptide repeat-containing protein At2g26790, mitochondrial isoform X2 [Sesamum indicum] Length = 743 Score = 57.0 bits (136), Expect = 9e-06 Identities = 29/80 (36%), Positives = 46/80 (57%) Frame = -2 Query: 678 LDPEVDSNSISWLFDLFHKMHKNPYIPDFVTYTVLITCYLKQGSIVQALKLYNKMKENGI 499 +D + S+++ LF++M + +PD VTYT L++ Y KQG + +AL L N+M GI Sbjct: 660 IDSQCKSDNLEDAICLFNEMIQQGLLPDTVTYTALLSGYCKQGDMEKALTLVNEMSSKGI 719 Query: 498 LPDDLTRKVLGLEFVKKRKI 439 PD T L V+ +K+ Sbjct: 720 QPDSRTMSTLHHGIVRAKKV 739 >ref|XP_011099771.1| pentatricopeptide repeat-containing protein At2g26790, mitochondrial isoform X1 [Sesamum indicum] Length = 823 Score = 57.0 bits (136), Expect = 9e-06 Identities = 29/80 (36%), Positives = 46/80 (57%) Frame = -2 Query: 678 LDPEVDSNSISWLFDLFHKMHKNPYIPDFVTYTVLITCYLKQGSIVQALKLYNKMKENGI 499 +D + S+++ LF++M + +PD VTYT L++ Y KQG + +AL L N+M GI Sbjct: 740 IDSQCKSDNLEDAICLFNEMIQQGLLPDTVTYTALLSGYCKQGDMEKALTLVNEMSSKGI 799 Query: 498 LPDDLTRKVLGLEFVKKRKI 439 PD T L V+ +K+ Sbjct: 800 QPDSRTMSTLHHGIVRAKKV 819