BLASTX nr result
ID: Astragalus23_contig00025143
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus23_contig00025143 (499 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PNX80416.1| hypothetical protein L195_g036415, partial [Trifo... 54 2e-06 >gb|PNX80416.1| hypothetical protein L195_g036415, partial [Trifolium pratense] Length = 95 Score = 53.5 bits (127), Expect = 2e-06 Identities = 22/35 (62%), Positives = 28/35 (80%) Frame = -1 Query: 106 IFGWRVLLNRVATREALYNRGILHSNLDKSCVFCF 2 +FGWR+LLNR+ TR AL+ RGIL + + SCVFCF Sbjct: 25 VFGWRLLLNRLPTRTALHRRGILSNPFESSCVFCF 59