BLASTX nr result
ID: Astragalus23_contig00024957
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus23_contig00024957 (422 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PNY16133.1| F-box family protein [Trifolium pratense] 74 1e-14 ref|XP_003615992.1| F-box and associated interaction domain prot... 69 4e-12 ref|XP_013460187.1| F-box and associated interaction domain prot... 68 1e-11 dbj|GAU35596.1| hypothetical protein TSUD_295320 [Trifolium subt... 70 3e-11 dbj|GAU36235.1| hypothetical protein TSUD_214320 [Trifolium subt... 69 7e-11 dbj|GAU36234.1| hypothetical protein TSUD_214310 [Trifolium subt... 67 2e-10 >gb|PNY16133.1| F-box family protein [Trifolium pratense] Length = 102 Score = 74.3 bits (181), Expect = 1e-14 Identities = 42/62 (67%), Positives = 47/62 (75%), Gaps = 3/62 (4%) Frame = +2 Query: 242 MDRKRKPIPSARARANQRSKHGKEKA---EAQESGTSFSDLPFSITTHILLRLPIKSVLI 412 M+RKR IPS RAR +R K GKEK E+QE GTSF+DLPF I T IL+RLPIKSVLI Sbjct: 1 MERKRDSIPSTRAR--KRGKTGKEKVDGVESQELGTSFADLPFPIITDILVRLPIKSVLI 58 Query: 413 CK 418 CK Sbjct: 59 CK 60 >ref|XP_003615992.1| F-box and associated interaction domain protein [Medicago truncatula] gb|AES98950.1| F-box and associated interaction domain protein [Medicago truncatula] Length = 153 Score = 69.3 bits (168), Expect = 4e-12 Identities = 44/79 (55%), Positives = 52/79 (65%), Gaps = 3/79 (3%) Frame = +2 Query: 191 CRQTSEALRPRASGSVAMDRKRKPIPSARARANQRSKHGKEKA---EAQESGTSFSDLPF 361 CRQTS + VAM+RK IPS RA+ +++K GKEK E QE SF+DLPF Sbjct: 31 CRQTSSL----SWYCVAMERKSGLIPSPRAK--KKAKTGKEKVDEVEIQELSPSFADLPF 84 Query: 362 SITTHILLRLPIKSVLICK 418 I T ILLRLPIKSV+ICK Sbjct: 85 PIATDILLRLPIKSVIICK 103 >ref|XP_013460187.1| F-box and associated interaction domain protein [Medicago truncatula] gb|KEH34218.1| F-box and associated interaction domain protein [Medicago truncatula] Length = 163 Score = 68.2 bits (165), Expect = 1e-11 Identities = 39/64 (60%), Positives = 44/64 (68%), Gaps = 3/64 (4%) Frame = +2 Query: 236 VAMDRKRKPIPSARARANQRSKHGKEKA---EAQESGTSFSDLPFSITTHILLRLPIKSV 406 VAM+RKR IPS R +R K GKEK E QE SF+DLPF I T +LLRLPIKSV Sbjct: 52 VAMERKRSLIPSPRD--TKRGKTGKEKVDVVETQELSPSFADLPFPIATDVLLRLPIKSV 109 Query: 407 LICK 418 L+CK Sbjct: 110 LVCK 113 >dbj|GAU35596.1| hypothetical protein TSUD_295320 [Trifolium subterraneum] Length = 433 Score = 70.1 bits (170), Expect = 3e-11 Identities = 40/62 (64%), Positives = 45/62 (72%), Gaps = 3/62 (4%) Frame = +2 Query: 242 MDRKRKPIPSARARANQRSKHGKEKA---EAQESGTSFSDLPFSITTHILLRLPIKSVLI 412 M+RKR IPSARAR +R K GKEK E+QE G SF+DLPF ITT ILLRL K +LI Sbjct: 1 MERKRGSIPSARAR--KRGKRGKEKVDDIESQELGPSFADLPFPITTDILLRLSTKPILI 58 Query: 413 CK 418 CK Sbjct: 59 CK 60 >dbj|GAU36235.1| hypothetical protein TSUD_214320 [Trifolium subterraneum] Length = 309 Score = 68.6 bits (166), Expect = 7e-11 Identities = 41/63 (65%), Positives = 44/63 (69%), Gaps = 3/63 (4%) Frame = +2 Query: 242 MDRKRKPIPSARARANQRSKHGKEKA---EAQESGTSFSDLPFSITTHILLRLPIKSVLI 412 M+RKR IPSARAR +R K G EK E QE G SF+DLPF IT ILLRL KSVLI Sbjct: 1 MERKRGSIPSARAR--KRGKTGNEKVDDIENQELGPSFADLPFPITNDILLRLSTKSVLI 58 Query: 413 CKR 421 CKR Sbjct: 59 CKR 61 >dbj|GAU36234.1| hypothetical protein TSUD_214310 [Trifolium subterraneum] Length = 357 Score = 67.4 bits (163), Expect = 2e-10 Identities = 39/63 (61%), Positives = 45/63 (71%), Gaps = 3/63 (4%) Frame = +2 Query: 242 MDRKRKPIPSARARANQRSKHGKEKA---EAQESGTSFSDLPFSITTHILLRLPIKSVLI 412 M+RKR IPSARAR +R K GKEK E++E G SF+DLPF I T ILLRL K +LI Sbjct: 1 MERKRGSIPSARAR--KRGKRGKEKIDDIESRELGPSFADLPFPIITDILLRLSTKLILI 58 Query: 413 CKR 421 CKR Sbjct: 59 CKR 61