BLASTX nr result
ID: Astragalus23_contig00024953
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus23_contig00024953 (359 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KYP34090.1| Retrovirus-related Pol polyprotein from transposo... 54 8e-06 >gb|KYP34090.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cajanus cajan] Length = 1270 Score = 53.9 bits (128), Expect = 8e-06 Identities = 26/38 (68%), Positives = 32/38 (84%), Gaps = 4/38 (10%) Frame = -2 Query: 211 IFFFRGVQREGEVKLLYCKTEEQV----TKALPKARFE 110 +FF R VQREG+VKL+YCK+E+QV TKALPK+RFE Sbjct: 1216 LFFLREVQREGQVKLVYCKSEDQVADILTKALPKSRFE 1253