BLASTX nr result
ID: Astragalus23_contig00024250
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus23_contig00024250 (291 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004494343.1| PREDICTED: spermatogenesis-associated protei... 57 3e-07 ref|XP_003625880.2| spermatogenesis-associated-like protein [Med... 55 2e-06 >ref|XP_004494343.1| PREDICTED: spermatogenesis-associated protein 20 [Cicer arietinum] Length = 800 Score = 57.0 bits (136), Expect = 3e-07 Identities = 32/51 (62%), Positives = 36/51 (70%), Gaps = 4/51 (7%) Frame = -1 Query: 141 QRSIGVLNRLFYHQ----TTSKFQFPFSFSHRVTLSKVLSMATSHSQSHHN 1 QRSI VLNRLFY TT+ F+FPFSFS R TL +LSMAT HS H+N Sbjct: 4 QRSIVVLNRLFYKHLSTTTTTNFRFPFSFS-RFTLPNILSMATLHSNQHNN 53 >ref|XP_003625880.2| spermatogenesis-associated-like protein [Medicago truncatula] gb|AES82098.2| spermatogenesis-associated-like protein [Medicago truncatula] Length = 798 Score = 54.7 bits (130), Expect = 2e-06 Identities = 33/51 (64%), Positives = 36/51 (70%), Gaps = 6/51 (11%) Frame = -1 Query: 141 QRSIGVLNRLFYHQ-----TTSKFQFPFSFSHRVTLSKVLSMAT-SHSQSH 7 QRSI VLNR FYH T++KF+ PF FS RVTL KVLSMAT SHS H Sbjct: 4 QRSISVLNRFFYHNQKHFPTSTKFRTPFKFS-RVTLPKVLSMATSSHSDQH 53