BLASTX nr result
ID: Astragalus23_contig00023508
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus23_contig00023508 (494 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004494051.1| PREDICTED: F-box/kelch-repeat protein At3g23... 68 3e-10 ref|XP_003623993.2| F-box and associated interaction domain prot... 68 3e-10 ref|XP_013452415.1| F-box and associated interaction domain prot... 64 6e-10 ref|XP_004492103.2| PREDICTED: F-box/kelch-repeat protein At3g23... 66 2e-09 ref|XP_004492102.2| PREDICTED: F-box/kelch-repeat protein At3g23... 66 2e-09 ref|XP_012568161.1| PREDICTED: putative F-box protein At1g47790 ... 63 2e-09 ref|XP_003623985.1| F-box and associated interaction domain prot... 62 2e-09 ref|XP_003623924.1| F-box protein interaction domain protein [Me... 65 2e-09 ref|XP_013455298.1| F-box protein interaction domain protein [Me... 65 2e-09 ref|XP_003621677.1| F-box-like protein [Medicago truncatula] >gi... 64 4e-09 ref|XP_004492107.2| PREDICTED: F-box/kelch-repeat protein At3g23... 64 6e-09 gb|PNX78163.1| F-box/kelch-repeat protein at3g23880-like protein... 64 6e-09 ref|XP_006574649.1| PREDICTED: F-box/kelch-repeat protein At3g23... 64 6e-09 ref|XP_013466453.1| F-box protein interaction domain protein [Me... 64 8e-09 ref|XP_004491778.1| PREDICTED: F-box/kelch-repeat protein At3g23... 64 8e-09 gb|ABN08681.1| Cyclin-like F-box [Medicago truncatula] 59 8e-09 ref|XP_013463747.1| F-box protein interaction domain protein [Me... 64 1e-08 ref|XP_013463765.1| F-box protein interaction domain protein [Me... 64 1e-08 ref|XP_003590345.1| F-box and associated interaction domain prot... 59 1e-08 ref|XP_003590548.1| F-box protein interaction domain protein [Me... 63 1e-08 >ref|XP_004494051.1| PREDICTED: F-box/kelch-repeat protein At3g23880-like [Cicer arietinum] Length = 390 Score = 68.2 bits (165), Expect = 3e-10 Identities = 32/46 (69%), Positives = 38/46 (82%) Frame = +2 Query: 356 PQEAVLPDDLIAEILSYLSVKTLMRLRTVSKSWKSLISNPTFVNLH 493 P VLPDDLI E+LS LSVK+L+RLR VSKSW++LIS+P FV LH Sbjct: 11 PSPVVLPDDLIPEVLSLLSVKSLLRLRCVSKSWRALISDPVFVKLH 56 >ref|XP_003623993.2| F-box and associated interaction domain protein [Medicago truncatula] gb|AES80211.2| F-box and associated interaction domain protein [Medicago truncatula] Length = 434 Score = 68.2 bits (165), Expect = 3e-10 Identities = 32/42 (76%), Positives = 39/42 (92%) Frame = +2 Query: 368 VLPDDLIAEILSYLSVKTLMRLRTVSKSWKSLISNPTFVNLH 493 VLPDDLIAE+LS+L VK+L+RL+ VSKSWKSLIS+P+FV LH Sbjct: 8 VLPDDLIAELLSFLPVKSLVRLKCVSKSWKSLISDPSFVKLH 49 >ref|XP_013452415.1| F-box and associated interaction domain protein [Medicago truncatula] gb|KEH26443.1| F-box and associated interaction domain protein [Medicago truncatula] Length = 145 Score = 64.3 bits (155), Expect = 6e-10 Identities = 30/42 (71%), Positives = 37/42 (88%) Frame = +2 Query: 368 VLPDDLIAEILSYLSVKTLMRLRTVSKSWKSLISNPTFVNLH 493 +LPD+LI EILS L+VK+LMRLR VSK WK+LIS+PTFV +H Sbjct: 28 ILPDELITEILSRLNVKSLMRLRCVSKLWKTLISDPTFVKMH 69 >ref|XP_004492103.2| PREDICTED: F-box/kelch-repeat protein At3g23880-like [Cicer arietinum] Length = 397 Score = 65.9 bits (159), Expect = 2e-09 Identities = 30/46 (65%), Positives = 38/46 (82%) Frame = +2 Query: 356 PQEAVLPDDLIAEILSYLSVKTLMRLRTVSKSWKSLISNPTFVNLH 493 P VL DDLI E+LS+LSVK+L+R+R VSKSW++LIS+P FV LH Sbjct: 11 PSPVVLSDDLIPEVLSFLSVKSLLRMRCVSKSWRALISDPVFVKLH 56 >ref|XP_004492102.2| PREDICTED: F-box/kelch-repeat protein At3g23880-like [Cicer arietinum] Length = 397 Score = 65.9 bits (159), Expect = 2e-09 Identities = 30/46 (65%), Positives = 38/46 (82%) Frame = +2 Query: 356 PQEAVLPDDLIAEILSYLSVKTLMRLRTVSKSWKSLISNPTFVNLH 493 P VL DDLI E+LS+LSVK+L+R+R VSKSW++LIS+P FV LH Sbjct: 11 PSPVVLSDDLIPEVLSFLSVKSLLRMRCVSKSWRALISDPVFVKLH 56 >ref|XP_012568161.1| PREDICTED: putative F-box protein At1g47790 [Cicer arietinum] Length = 138 Score = 62.8 bits (151), Expect = 2e-09 Identities = 29/46 (63%), Positives = 37/46 (80%) Frame = +2 Query: 356 PQEAVLPDDLIAEILSYLSVKTLMRLRTVSKSWKSLISNPTFVNLH 493 P V+ DDLI E+LS+LSVK+L+RL VSKSW++LIS+P FV LH Sbjct: 11 PSAVVISDDLIPEVLSFLSVKSLIRLGCVSKSWRALISDPVFVKLH 56 >ref|XP_003623985.1| F-box and associated interaction domain protein [Medicago truncatula] gb|AES80203.1| F-box and associated interaction domain protein [Medicago truncatula] Length = 99 Score = 61.6 bits (148), Expect = 2e-09 Identities = 28/42 (66%), Positives = 35/42 (83%) Frame = +2 Query: 368 VLPDDLIAEILSYLSVKTLMRLRTVSKSWKSLISNPTFVNLH 493 VLPDDLI EIL +L VK++++ R VS+SWKSL SNP+FV LH Sbjct: 18 VLPDDLITEILPFLPVKSILQFRCVSESWKSLTSNPSFVKLH 59 >ref|XP_003623924.1| F-box protein interaction domain protein [Medicago truncatula] gb|AES80142.1| F-box protein interaction domain protein [Medicago truncatula] Length = 431 Score = 65.5 bits (158), Expect = 2e-09 Identities = 31/42 (73%), Positives = 36/42 (85%) Frame = +2 Query: 368 VLPDDLIAEILSYLSVKTLMRLRTVSKSWKSLISNPTFVNLH 493 VLPDDLIAE+LS+L V L+R R+VSKSWK+LISNP FV LH Sbjct: 15 VLPDDLIAEVLSFLPVIFLLRFRSVSKSWKTLISNPAFVKLH 56 >ref|XP_013455298.1| F-box protein interaction domain protein [Medicago truncatula] gb|KEH29329.1| F-box protein interaction domain protein [Medicago truncatula] Length = 442 Score = 65.5 bits (158), Expect = 2e-09 Identities = 28/43 (65%), Positives = 38/43 (88%) Frame = +2 Query: 365 AVLPDDLIAEILSYLSVKTLMRLRTVSKSWKSLISNPTFVNLH 493 A+LPD+LIAE+LS+L VK+LM+LR+V KSWKS++ +PTFV H Sbjct: 25 AILPDELIAEVLSFLPVKSLMQLRSVCKSWKSIVEDPTFVKFH 67 >ref|XP_003621677.1| F-box-like protein [Medicago truncatula] gb|AES77895.1| F-box-like protein [Medicago truncatula] Length = 302 Score = 64.3 bits (155), Expect = 4e-09 Identities = 30/46 (65%), Positives = 36/46 (78%) Frame = +2 Query: 356 PQEAVLPDDLIAEILSYLSVKTLMRLRTVSKSWKSLISNPTFVNLH 493 P LPD+LI E+LS+L+VK LMRL+ VSKSWKSLIS PTFV + Sbjct: 28 PSSVFLPDELIVEVLSWLTVKQLMRLKYVSKSWKSLISEPTFVKFY 73 >ref|XP_004492107.2| PREDICTED: F-box/kelch-repeat protein At3g23880-like [Cicer arietinum] Length = 398 Score = 64.3 bits (155), Expect = 6e-09 Identities = 30/42 (71%), Positives = 37/42 (88%) Frame = +2 Query: 368 VLPDDLIAEILSYLSVKTLMRLRTVSKSWKSLISNPTFVNLH 493 VL DDLI E+LS+LSVK+L+RLR VSKSW++LIS+P FV LH Sbjct: 15 VLSDDLIPEVLSFLSVKSLLRLRCVSKSWRALISDPVFVKLH 56 >gb|PNX78163.1| F-box/kelch-repeat protein at3g23880-like protein [Trifolium pratense] Length = 420 Score = 64.3 bits (155), Expect = 6e-09 Identities = 29/47 (61%), Positives = 37/47 (78%) Frame = +2 Query: 353 IPQEAVLPDDLIAEILSYLSVKTLMRLRTVSKSWKSLISNPTFVNLH 493 +P VLP DLI E+LSYL VK+L+R R+V KSWK++I +PTFV LH Sbjct: 15 LPSTVVLPHDLIVEVLSYLPVKSLVRFRSVCKSWKTVIYDPTFVKLH 61 >ref|XP_006574649.1| PREDICTED: F-box/kelch-repeat protein At3g23880-like [Glycine max] gb|KHN00418.1| F-box/kelch-repeat protein [Glycine soja] gb|KRH69677.1| hypothetical protein GLYMA_02G041600 [Glycine max] Length = 423 Score = 64.3 bits (155), Expect = 6e-09 Identities = 30/42 (71%), Positives = 34/42 (80%) Frame = +2 Query: 368 VLPDDLIAEILSYLSVKTLMRLRTVSKSWKSLISNPTFVNLH 493 VLP+DLI EILS++ VK LMR R VSKSW SLI NPTF+ LH Sbjct: 9 VLPEDLIVEILSWVEVKNLMRFRCVSKSWNSLIFNPTFIKLH 50 >ref|XP_013466453.1| F-box protein interaction domain protein [Medicago truncatula] gb|KEH40494.1| F-box protein interaction domain protein [Medicago truncatula] Length = 405 Score = 63.9 bits (154), Expect = 8e-09 Identities = 30/46 (65%), Positives = 37/46 (80%) Frame = +2 Query: 356 PQEAVLPDDLIAEILSYLSVKTLMRLRTVSKSWKSLISNPTFVNLH 493 P AVL +DL+AE+LS+L VK+L+ R VSKSWK+LIS PTFV LH Sbjct: 3 PSPAVLSEDLVAEVLSFLPVKSLVCFRCVSKSWKTLISEPTFVKLH 48 >ref|XP_004491778.1| PREDICTED: F-box/kelch-repeat protein At3g23880-like [Cicer arietinum] Length = 432 Score = 63.9 bits (154), Expect = 8e-09 Identities = 33/54 (61%), Positives = 40/54 (74%), Gaps = 5/54 (9%) Frame = +2 Query: 347 MDIPQEAV-----LPDDLIAEILSYLSVKTLMRLRTVSKSWKSLISNPTFVNLH 493 MD P V +PD LIAEILS+LSVKT++RL+ VSKSW +LIS+PTFV H Sbjct: 1 MDFPNRRVFPPAFIPDHLIAEILSFLSVKTILRLKCVSKSWYTLISHPTFVQNH 54 >gb|ABN08681.1| Cyclin-like F-box [Medicago truncatula] Length = 72 Score = 59.3 bits (142), Expect = 8e-09 Identities = 27/40 (67%), Positives = 33/40 (82%) Frame = +2 Query: 374 PDDLIAEILSYLSVKTLMRLRTVSKSWKSLISNPTFVNLH 493 PD+LIAE+LS+L VK LM L+ +SKSW +LIS PTFV LH Sbjct: 10 PDELIAEVLSFLQVKPLMLLKCMSKSWNTLISEPTFVKLH 49 >ref|XP_013463747.1| F-box protein interaction domain protein [Medicago truncatula] gb|KEH37782.1| F-box protein interaction domain protein [Medicago truncatula] Length = 395 Score = 63.5 bits (153), Expect = 1e-08 Identities = 29/46 (63%), Positives = 37/46 (80%) Frame = +2 Query: 356 PQEAVLPDDLIAEILSYLSVKTLMRLRTVSKSWKSLISNPTFVNLH 493 P +LPDDLIAE+L++L VK+L +L+ VSKSW SLIS+P FV LH Sbjct: 15 PSPVILPDDLIAEVLAFLDVKSLTQLKCVSKSWYSLISDPFFVKLH 60 >ref|XP_013463765.1| F-box protein interaction domain protein [Medicago truncatula] gb|KEH37800.1| F-box protein interaction domain protein [Medicago truncatula] Length = 398 Score = 63.5 bits (153), Expect = 1e-08 Identities = 28/46 (60%), Positives = 37/46 (80%) Frame = +2 Query: 356 PQEAVLPDDLIAEILSYLSVKTLMRLRTVSKSWKSLISNPTFVNLH 493 P +LPD+L+AE+LS+L V +LM+L+ VSKSW SLIS+P FV LH Sbjct: 17 PSPVILPDELVAEVLSFLPVNSLMQLKCVSKSWNSLISDPFFVKLH 62 >ref|XP_003590345.1| F-box and associated interaction domain protein [Medicago truncatula] gb|AES60596.1| F-box and associated interaction domain protein [Medicago truncatula] Length = 83 Score = 59.3 bits (142), Expect = 1e-08 Identities = 26/43 (60%), Positives = 37/43 (86%) Frame = +2 Query: 365 AVLPDDLIAEILSYLSVKTLMRLRTVSKSWKSLISNPTFVNLH 493 ++L +DLI E+LS+L V++L+R R+VSK WK+LIS+PTFV LH Sbjct: 9 SILSNDLILEVLSFLPVRSLIRFRSVSKCWKTLISDPTFVKLH 51 >ref|XP_003590548.1| F-box protein interaction domain protein [Medicago truncatula] gb|AES60799.1| F-box protein interaction domain protein [Medicago truncatula] Length = 388 Score = 63.2 bits (152), Expect = 1e-08 Identities = 29/53 (54%), Positives = 39/53 (73%) Frame = +2 Query: 335 TSLMMDIPQEAVLPDDLIAEILSYLSVKTLMRLRTVSKSWKSLISNPTFVNLH 493 T M + V PDD+IAEILS+L+VKTLM+++ VSKSW +LIS+ FV +H Sbjct: 3 TRSRMSLSSSPVFPDDIIAEILSWLTVKTLMKMKCVSKSWNTLISDSNFVKMH 55