BLASTX nr result
ID: Astragalus23_contig00023386
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus23_contig00023386 (433 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KRH20148.1| hypothetical protein GLYMA_13G159700 [Glycine max] 50 1e-05 gb|ACU17075.1| unknown [Glycine max] 50 1e-05 >gb|KRH20148.1| hypothetical protein GLYMA_13G159700 [Glycine max] Length = 58 Score = 50.4 bits (119), Expect = 1e-05 Identities = 23/30 (76%), Positives = 24/30 (80%) Frame = +2 Query: 215 SFFACMLWLSCFYILFCGSIKLWEDTNRVN 304 S FACM W S ILFCGSIKLWEDT+RVN Sbjct: 17 SSFACMPWHSYSQILFCGSIKLWEDTDRVN 46 >gb|ACU17075.1| unknown [Glycine max] Length = 58 Score = 50.4 bits (119), Expect = 1e-05 Identities = 23/30 (76%), Positives = 24/30 (80%) Frame = +2 Query: 215 SFFACMLWLSCFYILFCGSIKLWEDTNRVN 304 S FACM W S ILFCGSIKLWEDT+RVN Sbjct: 17 SSFACMPWHSYSQILFCGSIKLWEDTDRVN 46