BLASTX nr result
ID: Astragalus23_contig00023326
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus23_contig00023326 (323 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003630643.1| 2,3-diketo-5-methylthio-1-phosphopentane pho... 87 1e-18 ref|XP_014509235.1| inorganic pyrophosphatase 2 [Vigna radiata v... 86 3e-18 ref|XP_004503534.1| PREDICTED: inorganic pyrophosphatase 3 [Cice... 86 4e-18 ref|XP_020215841.1| LOW QUALITY PROTEIN: thiamine phosphate phos... 85 5e-18 gb|KYP67527.1| putative phosphatase phospho2 [Cajanus cajan] 85 3e-17 dbj|GAU11784.1| hypothetical protein TSUD_75350 [Trifolium subte... 84 3e-17 gb|KOM57879.1| hypothetical protein LR48_Vigan11g091200 [Vigna a... 84 3e-17 ref|XP_017441595.1| PREDICTED: inorganic pyrophosphatase 3 isofo... 84 3e-17 ref|XP_017441594.1| PREDICTED: inorganic pyrophosphatase 3 isofo... 84 3e-17 gb|KHN16679.1| Inorganic pyrophosphatase 3 [Glycine soja] >gi|94... 81 3e-16 ref|NP_001235542.1| uncharacterized protein LOC100306472 [Glycin... 81 3e-16 ref|XP_007160240.1| hypothetical protein PHAVU_002G304600g [Phas... 80 5e-16 ref|XP_019447238.1| PREDICTED: inorganic pyrophosphatase 2-like ... 79 1e-15 gb|PNY01437.1| pyridoxal phosphate phosphatase phospho2, partial... 79 2e-15 gb|OIW09962.1| hypothetical protein TanjilG_18269 [Lupinus angus... 79 2e-15 ref|XP_018819044.1| PREDICTED: inorganic pyrophosphatase 3-like ... 76 3e-14 ref|XP_013444285.1| 2,3-diketo-5-methylthio-1-phosphopentane pho... 73 4e-13 ref|XP_013444287.1| 2,3-diketo-5-methylthio-1-phosphopentane pho... 73 5e-13 gb|KDO59254.1| hypothetical protein CISIN_1g044617mg [Citrus sin... 72 6e-13 ref|XP_006451424.1| thiamine phosphate phosphatase-like protein ... 72 6e-13 >ref|XP_003630643.1| 2,3-diketo-5-methylthio-1-phosphopentane phosphatase [Medicago truncatula] gb|AET05119.1| 2,3-diketo-5-methylthio-1-phosphopentane phosphatase [Medicago truncatula] Length = 238 Score = 87.0 bits (214), Expect = 1e-18 Identities = 37/47 (78%), Positives = 44/47 (93%) Frame = +2 Query: 2 DFVMPRKNYPLWKQICSDPKLVDARVHDWNSGEELETILLNLISKLT 142 DFVMPRKNYPLW +ICSDPKLV A+VHDW++GEELE+ILLNL++K T Sbjct: 192 DFVMPRKNYPLWNRICSDPKLVHAKVHDWSNGEELESILLNLVNKAT 238 >ref|XP_014509235.1| inorganic pyrophosphatase 2 [Vigna radiata var. radiata] Length = 245 Score = 86.3 bits (212), Expect = 3e-18 Identities = 39/50 (78%), Positives = 45/50 (90%) Frame = +2 Query: 2 DFVMPRKNYPLWKQICSDPKLVDARVHDWNSGEELETILLNLISKLTATT 151 DFVMPRKNYPLW QI SDPKLV A VHDW++GEELE+ILLNLI+K+T T+ Sbjct: 195 DFVMPRKNYPLWNQIQSDPKLVAAEVHDWSNGEELESILLNLINKITPTS 244 >ref|XP_004503534.1| PREDICTED: inorganic pyrophosphatase 3 [Cicer arietinum] ref|XP_012572111.1| PREDICTED: inorganic pyrophosphatase 3 [Cicer arietinum] Length = 238 Score = 85.5 bits (210), Expect = 4e-18 Identities = 37/46 (80%), Positives = 41/46 (89%) Frame = +2 Query: 2 DFVMPRKNYPLWKQICSDPKLVDARVHDWNSGEELETILLNLISKL 139 DFVMPRKNYPLW +ICSDPKLV A VHDW+SGEE E ILLNL++KL Sbjct: 191 DFVMPRKNYPLWNKICSDPKLVHAEVHDWSSGEEFENILLNLVNKL 236 >ref|XP_020215841.1| LOW QUALITY PROTEIN: thiamine phosphate phosphatase-like protein [Cajanus cajan] Length = 225 Score = 85.1 bits (209), Expect = 5e-18 Identities = 39/49 (79%), Positives = 44/49 (89%) Frame = +2 Query: 2 DFVMPRKNYPLWKQICSDPKLVDARVHDWNSGEELETILLNLISKLTAT 148 DFVMPRKNYPLW +I SDPKLV A VHDW++GEELE+ILLNLI+KLT T Sbjct: 154 DFVMPRKNYPLWNRIHSDPKLVAAEVHDWSNGEELESILLNLINKLTPT 202 >gb|KYP67527.1| putative phosphatase phospho2 [Cajanus cajan] Length = 343 Score = 85.1 bits (209), Expect = 3e-17 Identities = 39/49 (79%), Positives = 44/49 (89%) Frame = +2 Query: 2 DFVMPRKNYPLWKQICSDPKLVDARVHDWNSGEELETILLNLISKLTAT 148 DFVMPRKNYPLW +I SDPKLV A VHDW++GEELE+ILLNLI+KLT T Sbjct: 203 DFVMPRKNYPLWNRIHSDPKLVAAEVHDWSNGEELESILLNLINKLTPT 251 >dbj|GAU11784.1| hypothetical protein TSUD_75350 [Trifolium subterraneum] Length = 241 Score = 83.6 bits (205), Expect = 3e-17 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = +2 Query: 2 DFVMPRKNYPLWKQICSDPKLVDARVHDWNSGEELETILLNLISKL 139 DFVMPRKNYPLW +ICSDP LV A VHDW++GEELE ILLNL++KL Sbjct: 194 DFVMPRKNYPLWNRICSDPNLVHATVHDWSNGEELENILLNLVNKL 239 >gb|KOM57879.1| hypothetical protein LR48_Vigan11g091200 [Vigna angularis] Length = 243 Score = 83.6 bits (205), Expect = 3e-17 Identities = 37/47 (78%), Positives = 43/47 (91%) Frame = +2 Query: 2 DFVMPRKNYPLWKQICSDPKLVDARVHDWNSGEELETILLNLISKLT 142 DFVMPRKNYPLW +I SDPKLV A VHDW++GEELE+ILLNLI+K+T Sbjct: 195 DFVMPRKNYPLWNRIQSDPKLVSAEVHDWSNGEELESILLNLINKIT 241 >ref|XP_017441595.1| PREDICTED: inorganic pyrophosphatase 3 isoform X2 [Vigna angularis] dbj|BAT72919.1| hypothetical protein VIGAN_01036500 [Vigna angularis var. angularis] Length = 257 Score = 83.6 bits (205), Expect = 3e-17 Identities = 37/47 (78%), Positives = 43/47 (91%) Frame = +2 Query: 2 DFVMPRKNYPLWKQICSDPKLVDARVHDWNSGEELETILLNLISKLT 142 DFVMPRKNYPLW +I SDPKLV A VHDW++GEELE+ILLNLI+K+T Sbjct: 209 DFVMPRKNYPLWNRIQSDPKLVSAEVHDWSNGEELESILLNLINKIT 255 >ref|XP_017441594.1| PREDICTED: inorganic pyrophosphatase 3 isoform X1 [Vigna angularis] Length = 259 Score = 83.6 bits (205), Expect = 3e-17 Identities = 37/47 (78%), Positives = 43/47 (91%) Frame = +2 Query: 2 DFVMPRKNYPLWKQICSDPKLVDARVHDWNSGEELETILLNLISKLT 142 DFVMPRKNYPLW +I SDPKLV A VHDW++GEELE+ILLNLI+K+T Sbjct: 211 DFVMPRKNYPLWNRIQSDPKLVSAEVHDWSNGEELESILLNLINKIT 257 >gb|KHN16679.1| Inorganic pyrophosphatase 3 [Glycine soja] gb|KRH41434.1| hypothetical protein GLYMA_08G029600 [Glycine max] Length = 246 Score = 80.9 bits (198), Expect = 3e-16 Identities = 35/47 (74%), Positives = 44/47 (93%) Frame = +2 Query: 2 DFVMPRKNYPLWKQICSDPKLVDARVHDWNSGEELETILLNLISKLT 142 DFVMPRKNYPLW +I SDPKLV A++HDW++GE+LETILLNLI+K++ Sbjct: 199 DFVMPRKNYPLWNKIHSDPKLVAAQLHDWSTGEDLETILLNLINKIS 245 >ref|NP_001235542.1| uncharacterized protein LOC100306472 [Glycine max] gb|ACU14672.1| unknown [Glycine max] Length = 246 Score = 80.9 bits (198), Expect = 3e-16 Identities = 35/47 (74%), Positives = 44/47 (93%) Frame = +2 Query: 2 DFVMPRKNYPLWKQICSDPKLVDARVHDWNSGEELETILLNLISKLT 142 DFVMPRKNYPLW +I SDPKLV A++HDW++GE+LETILLNLI+K++ Sbjct: 199 DFVMPRKNYPLWNKIHSDPKLVAAQLHDWSTGEDLETILLNLINKIS 245 >ref|XP_007160240.1| hypothetical protein PHAVU_002G304600g [Phaseolus vulgaris] gb|ESW32234.1| hypothetical protein PHAVU_002G304600g [Phaseolus vulgaris] Length = 254 Score = 80.5 bits (197), Expect = 5e-16 Identities = 36/50 (72%), Positives = 43/50 (86%) Frame = +2 Query: 2 DFVMPRKNYPLWKQICSDPKLVDARVHDWNSGEELETILLNLISKLTATT 151 DFVMPRKNYPLW +I SDPKLV A VHDW++GEELE+ILL LI+K+ T+ Sbjct: 195 DFVMPRKNYPLWNRIHSDPKLVAAEVHDWSNGEELESILLKLINKIAPTS 244 >ref|XP_019447238.1| PREDICTED: inorganic pyrophosphatase 2-like [Lupinus angustifolius] Length = 240 Score = 79.0 bits (193), Expect = 1e-15 Identities = 35/46 (76%), Positives = 41/46 (89%) Frame = +2 Query: 2 DFVMPRKNYPLWKQICSDPKLVDARVHDWNSGEELETILLNLISKL 139 DFVMPRK+YPLW QI SDPKLV+A VH+W++GEELE LLNLI+KL Sbjct: 192 DFVMPRKDYPLWDQISSDPKLVNAEVHEWSNGEELENTLLNLINKL 237 >gb|PNY01437.1| pyridoxal phosphate phosphatase phospho2, partial [Trifolium pratense] Length = 247 Score = 79.0 bits (193), Expect = 2e-15 Identities = 35/46 (76%), Positives = 40/46 (86%) Frame = +2 Query: 2 DFVMPRKNYPLWKQICSDPKLVDARVHDWNSGEELETILLNLISKL 139 DFVMPRKNYPLW +I +DPKLV A VHDW++GEELE ILLNL+ KL Sbjct: 200 DFVMPRKNYPLWDRIGTDPKLVHATVHDWSNGEELENILLNLVKKL 245 >gb|OIW09962.1| hypothetical protein TanjilG_18269 [Lupinus angustifolius] Length = 251 Score = 79.0 bits (193), Expect = 2e-15 Identities = 35/46 (76%), Positives = 41/46 (89%) Frame = +2 Query: 2 DFVMPRKNYPLWKQICSDPKLVDARVHDWNSGEELETILLNLISKL 139 DFVMPRK+YPLW QI SDPKLV+A VH+W++GEELE LLNLI+KL Sbjct: 203 DFVMPRKDYPLWDQISSDPKLVNAEVHEWSNGEELENTLLNLINKL 248 >ref|XP_018819044.1| PREDICTED: inorganic pyrophosphatase 3-like [Juglans regia] Length = 252 Score = 75.9 bits (185), Expect = 3e-14 Identities = 32/56 (57%), Positives = 45/56 (80%) Frame = +2 Query: 2 DFVMPRKNYPLWKQICSDPKLVDARVHDWNSGEELETILLNLISKLTATT*LAQHK 169 D+VMPRKNYPLWK+IC +P LV A+VH+W++GEEL+ ILL LI +T +++H+ Sbjct: 195 DYVMPRKNYPLWKRICCEPLLVKAKVHEWSTGEELKRILLYLIDTITIQDNISRHQ 250 >ref|XP_013444285.1| 2,3-diketo-5-methylthio-1-phosphopentane phosphatase [Medicago truncatula] gb|KEH18312.1| 2,3-diketo-5-methylthio-1-phosphopentane phosphatase [Medicago truncatula] Length = 267 Score = 72.8 bits (177), Expect = 4e-13 Identities = 29/46 (63%), Positives = 37/46 (80%) Frame = +2 Query: 2 DFVMPRKNYPLWKQICSDPKLVDARVHDWNSGEELETILLNLISKL 139 DFVMPRKN+P+W IC DP LV A +H W+ GEELE +L+NLI+K+ Sbjct: 194 DFVMPRKNFPVWDLICKDPSLVKAEIHGWSDGEELEQVLMNLINKI 239 >ref|XP_013444287.1| 2,3-diketo-5-methylthio-1-phosphopentane phosphatase [Medicago truncatula] gb|KEH18314.1| 2,3-diketo-5-methylthio-1-phosphopentane phosphatase [Medicago truncatula] Length = 274 Score = 72.8 bits (177), Expect = 5e-13 Identities = 29/46 (63%), Positives = 37/46 (80%) Frame = +2 Query: 2 DFVMPRKNYPLWKQICSDPKLVDARVHDWNSGEELETILLNLISKL 139 DFVMPRKN+P+W IC DP LV A +H W+ GEELE +L+NLI+K+ Sbjct: 195 DFVMPRKNFPVWDLICKDPSLVKAEIHGWSDGEELEQVLMNLINKI 240 >gb|KDO59254.1| hypothetical protein CISIN_1g044617mg [Citrus sinensis] Length = 265 Score = 72.4 bits (176), Expect = 6e-13 Identities = 30/47 (63%), Positives = 40/47 (85%) Frame = +2 Query: 2 DFVMPRKNYPLWKQICSDPKLVDARVHDWNSGEELETILLNLISKLT 142 DFVMPRKNYPLW +ICS+P L+ A+VH+W+S EEL+ ILL+LI ++ Sbjct: 192 DFVMPRKNYPLWDRICSNPMLIKAKVHEWSSAEELKKILLHLIGAIS 238 >ref|XP_006451424.1| thiamine phosphate phosphatase-like protein [Citrus clementina] ref|XP_006475406.1| PREDICTED: inorganic pyrophosphatase 3 [Citrus sinensis] gb|ESR64664.1| hypothetical protein CICLE_v10009204mg [Citrus clementina] dbj|GAY50458.1| hypothetical protein CUMW_126820 [Citrus unshiu] Length = 265 Score = 72.4 bits (176), Expect = 6e-13 Identities = 30/47 (63%), Positives = 40/47 (85%) Frame = +2 Query: 2 DFVMPRKNYPLWKQICSDPKLVDARVHDWNSGEELETILLNLISKLT 142 DFVMPRKNYPLW +ICS+P L+ A+VH+W+S EEL+ ILL+LI ++ Sbjct: 192 DFVMPRKNYPLWDRICSNPMLIKAKVHEWSSAEELKKILLHLIGAIS 238