BLASTX nr result
ID: Astragalus23_contig00023064
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus23_contig00023064 (367 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GAU25614.1| hypothetical protein TSUD_260480 [Trifolium subt... 54 2e-06 dbj|GAU18667.1| hypothetical protein TSUD_125000 [Trifolium subt... 53 9e-06 >dbj|GAU25614.1| hypothetical protein TSUD_260480 [Trifolium subterraneum] Length = 153 Score = 53.9 bits (128), Expect = 2e-06 Identities = 35/89 (39%), Positives = 45/89 (50%) Frame = +2 Query: 47 DISLTPSLLMPLRRVSLKGVVGIALFLGSPMLPRHMWSCLLPYLRCHASHHKLSAFNMV* 226 + L LL+ + + L G+ G ++ P + S L A+ + S V Sbjct: 23 EFGLLQDLLLVVTQFPLSGMEGSWVWTLDPTGNYSVKSAYLAITSVEAAPEQNSLLTRVW 82 Query: 227 KSLAPSKVITFSWQLLLDCAPTRTNLLRR 313 KS APSKVI FSWQLL D PTR NLLRR Sbjct: 83 KSWAPSKVIVFSWQLLQDRVPTRQNLLRR 111 >dbj|GAU18667.1| hypothetical protein TSUD_125000 [Trifolium subterraneum] Length = 229 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/35 (74%), Positives = 27/35 (77%) Frame = +2 Query: 227 KSLAPSKVITFSWQLLLDCAPTRTNLLRRHAIPNP 331 KS APSKVI FSWQLLLD PTR NLLRR I +P Sbjct: 66 KSWAPSKVIVFSWQLLLDRVPTRQNLLRRRVIRDP 100