BLASTX nr result
ID: Astragalus23_contig00022715
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus23_contig00022715 (685 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_013450901.1| hypothetical protein MTR_6g009455 [Medicago ... 54 2e-06 >ref|XP_013450901.1| hypothetical protein MTR_6g009455 [Medicago truncatula] gb|KEH24941.1| hypothetical protein MTR_6g009455 [Medicago truncatula] Length = 56 Score = 53.9 bits (128), Expect = 2e-06 Identities = 23/35 (65%), Positives = 27/35 (77%) Frame = -3 Query: 518 KSSNPLHKAMEYETTPTEAPPVRAVPSTPDTSIYD 414 K++ PL KAMEYETTP E PPV+ PSTP+ IYD Sbjct: 3 KAATPLSKAMEYETTPAEMPPVKVAPSTPEPLIYD 37