BLASTX nr result
ID: Astragalus23_contig00022540
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus23_contig00022540 (333 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PNX97383.1| hypothetical protein L195_g020612 [Trifolium prat... 60 1e-09 dbj|GAU27564.1| hypothetical protein TSUD_29960 [Trifolium subte... 62 8e-09 ref|XP_003597575.1| hypothetical protein MTR_2g099760 [Medicago ... 57 1e-08 >gb|PNX97383.1| hypothetical protein L195_g020612 [Trifolium pratense] gb|PNY02086.1| hypothetical protein L195_g025390 [Trifolium pratense] Length = 83 Score = 60.1 bits (144), Expect = 1e-09 Identities = 23/38 (60%), Positives = 30/38 (78%) Frame = +1 Query: 127 FDIGENPNPNPVKTGKPIKSGRVWVGTHRYGFCCHAYL 240 F+IGENPNPNP+ + P+K+GR+W T YGF C+AYL Sbjct: 11 FEIGENPNPNPINSVFPVKAGRIWADTRWYGFYCNAYL 48 >dbj|GAU27564.1| hypothetical protein TSUD_29960 [Trifolium subterraneum] Length = 305 Score = 61.6 bits (148), Expect = 8e-09 Identities = 29/54 (53%), Positives = 35/54 (64%) Frame = +1 Query: 97 ISSLLAPSPYFDIGENPNPNPVKTGKPIKSGRVWVGTHRYGFCCHAYLQGSALG 258 +S LLAP+P F+IGENP NP P+K+GRVW GT GF CHAY + G Sbjct: 1 MSMLLAPNPSFEIGENPYSNP----NPVKAGRVWAGTRGNGFYCHAYWPSPSSG 50 >ref|XP_003597575.1| hypothetical protein MTR_2g099760 [Medicago truncatula] gb|AES67826.1| hypothetical protein MTR_2g099760 [Medicago truncatula] Length = 51 Score = 56.6 bits (135), Expect = 1e-08 Identities = 29/51 (56%), Positives = 30/51 (58%) Frame = +1 Query: 82 SGWGPISSLLAPSPYFDIGENPNPNPVKTGKPIKSGRVWVGTHRYGFCCHA 234 SGW I L P F GENP NPVKT KP+K V G H YGFCCHA Sbjct: 3 SGWVLIYPLPVSYPCF--GENPYSNPVKTEKPVKLDLVRAGNHGYGFCCHA 51