BLASTX nr result
ID: Astragalus23_contig00022381
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus23_contig00022381 (422 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003520002.1| PREDICTED: two-component response regulator ... 44 8e-07 ref|XP_014621351.1| PREDICTED: two-component response regulator ... 44 8e-07 ref|XP_020232669.1| two-component response regulator ORR21-like ... 43 3e-06 gb|KYP49986.1| Two-component response regulator ARR2, partial [C... 43 3e-06 >ref|XP_003520002.1| PREDICTED: two-component response regulator ORR21 isoform X1 [Glycine max] gb|KHN15459.1| Two-component response regulator ARR2 [Glycine soja] gb|KRH70359.1| hypothetical protein GLYMA_02G085900 [Glycine max] Length = 633 Score = 43.9 bits (102), Expect(2) = 8e-07 Identities = 23/33 (69%), Positives = 27/33 (81%), Gaps = 1/33 (3%) Frame = -1 Query: 422 IESSASDFSQLKVSVDSNGN-RVEETNFITNPK 327 IESS SDFSQ+KV+VDS+GN R +E NFI PK Sbjct: 581 IESSVSDFSQMKVNVDSSGNTRNQEPNFINIPK 613 Score = 36.6 bits (83), Expect(2) = 8e-07 Identities = 15/24 (62%), Positives = 19/24 (79%) Frame = -3 Query: 228 SFVTNPKVSLPILQRYPSHDHSSV 157 +F+ PKVS PI++RYPS DHS V Sbjct: 607 NFINIPKVSHPIIERYPSRDHSRV 630 >ref|XP_014621351.1| PREDICTED: two-component response regulator ORR21 isoform X2 [Glycine max] gb|KRH70360.1| hypothetical protein GLYMA_02G085900 [Glycine max] Length = 606 Score = 43.9 bits (102), Expect(2) = 8e-07 Identities = 23/33 (69%), Positives = 27/33 (81%), Gaps = 1/33 (3%) Frame = -1 Query: 422 IESSASDFSQLKVSVDSNGN-RVEETNFITNPK 327 IESS SDFSQ+KV+VDS+GN R +E NFI PK Sbjct: 554 IESSVSDFSQMKVNVDSSGNTRNQEPNFINIPK 586 Score = 36.6 bits (83), Expect(2) = 8e-07 Identities = 15/24 (62%), Positives = 19/24 (79%) Frame = -3 Query: 228 SFVTNPKVSLPILQRYPSHDHSSV 157 +F+ PKVS PI++RYPS DHS V Sbjct: 580 NFINIPKVSHPIIERYPSRDHSRV 603 >ref|XP_020232669.1| two-component response regulator ORR21-like [Cajanus cajan] ref|XP_020232670.1| two-component response regulator ORR21-like [Cajanus cajan] Length = 644 Score = 43.1 bits (100), Expect(2) = 3e-06 Identities = 22/33 (66%), Positives = 27/33 (81%), Gaps = 1/33 (3%) Frame = -1 Query: 422 IESSASDFSQLKVSVDSNGNRV-EETNFITNPK 327 IESS +DFSQ+KV+VDS+GN + EE NFI PK Sbjct: 592 IESSVTDFSQMKVNVDSSGNTLKEEPNFINFPK 624 Score = 35.4 bits (80), Expect(2) = 3e-06 Identities = 15/24 (62%), Positives = 19/24 (79%) Frame = -3 Query: 228 SFVTNPKVSLPILQRYPSHDHSSV 157 +F+ PKVS PI++RYPS D SSV Sbjct: 618 NFINFPKVSHPIIERYPSRDRSSV 641 >gb|KYP49986.1| Two-component response regulator ARR2, partial [Cajanus cajan] Length = 603 Score = 43.1 bits (100), Expect(2) = 3e-06 Identities = 22/33 (66%), Positives = 27/33 (81%), Gaps = 1/33 (3%) Frame = -1 Query: 422 IESSASDFSQLKVSVDSNGNRV-EETNFITNPK 327 IESS +DFSQ+KV+VDS+GN + EE NFI PK Sbjct: 551 IESSVTDFSQMKVNVDSSGNTLKEEPNFINFPK 583 Score = 35.4 bits (80), Expect(2) = 3e-06 Identities = 15/24 (62%), Positives = 19/24 (79%) Frame = -3 Query: 228 SFVTNPKVSLPILQRYPSHDHSSV 157 +F+ PKVS PI++RYPS D SSV Sbjct: 577 NFINFPKVSHPIIERYPSRDRSSV 600