BLASTX nr result
ID: Astragalus23_contig00022322
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus23_contig00022322 (359 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010111192.1| probable LRR receptor-like serine/threonine-... 57 6e-07 ref|XP_015956440.1| receptor-like protein kinase At5g59670 [Arac... 57 6e-07 ref|XP_004485811.1| PREDICTED: receptor-like protein kinase At3g... 57 6e-07 ref|XP_016190066.1| receptor-like protein kinase At5g59670 [Arac... 57 8e-07 ref|XP_010052291.1| PREDICTED: putative leucine-rich repeat rece... 55 3e-06 dbj|GAU23619.1| hypothetical protein TSUD_386080 [Trifolium subt... 54 7e-06 gb|OIV91728.1| hypothetical protein TanjilG_26581 [Lupinus angus... 54 1e-05 ref|XP_011043422.1| PREDICTED: putative leucine-rich repeat rece... 54 1e-05 gb|KYP39538.1| Receptor-like protein kinase At5g59670 family [Ca... 54 1e-05 ref|XP_016180684.1| putative leucine-rich repeat receptor-like s... 54 1e-05 ref|XP_015943060.1| putative leucine-rich repeat receptor-like s... 54 1e-05 gb|PNT11968.1| hypothetical protein POPTR_011G056800v3 [Populus ... 54 1e-05 ref|XP_020203002.1| putative leucine-rich repeat receptor-like s... 54 1e-05 ref|XP_011043421.1| PREDICTED: putative leucine-rich repeat rece... 54 1e-05 ref|XP_019425561.1| PREDICTED: receptor-like protein kinase At3g... 54 1e-05 >ref|XP_010111192.1| probable LRR receptor-like serine/threonine-protein kinase At1g51880 [Morus notabilis] gb|EXC30583.1| hypothetical protein L484_015076 [Morus notabilis] Length = 623 Score = 57.0 bits (136), Expect = 6e-07 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = +2 Query: 32 RTHYSRDIQMTRHHNHGNTHTAVEDGPVLLS 124 RTH SRDIQMTRHHNHGN TA E+GP LLS Sbjct: 593 RTHLSRDIQMTRHHNHGNARTAAENGPSLLS 623 >ref|XP_015956440.1| receptor-like protein kinase At5g59670 [Arachis duranensis] Length = 628 Score = 57.0 bits (136), Expect = 6e-07 Identities = 26/32 (81%), Positives = 30/32 (93%), Gaps = 1/32 (3%) Frame = +2 Query: 32 RTHYSRDIQMTR-HHNHGNTHTAVEDGPVLLS 124 RTHYSRDIQMTR HH+H +THTAVE+GP+LLS Sbjct: 597 RTHYSRDIQMTRHHHHHTHTHTAVENGPILLS 628 >ref|XP_004485811.1| PREDICTED: receptor-like protein kinase At3g21340 [Cicer arietinum] Length = 630 Score = 57.0 bits (136), Expect = 6e-07 Identities = 23/30 (76%), Positives = 28/30 (93%) Frame = +2 Query: 32 RTHYSRDIQMTRHHNHGNTHTAVEDGPVLL 121 RTH+SRDIQMTRH+N+GN HTA E+GP+LL Sbjct: 599 RTHFSRDIQMTRHNNYGNAHTAAENGPILL 628 >ref|XP_016190066.1| receptor-like protein kinase At5g59670 [Arachis ipaensis] Length = 626 Score = 56.6 bits (135), Expect = 8e-07 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = +2 Query: 32 RTHYSRDIQMTRHHNHGNTHTAVEDGPVLLS 124 RTHYSRDIQMTRHH H +THTAVE+GP+LLS Sbjct: 597 RTHYSRDIQMTRHH-HTHTHTAVENGPILLS 626 >ref|XP_010052291.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein kinase At2g14440 [Eucalyptus grandis] gb|KCW76223.1| hypothetical protein EUGRSUZ_D00605 [Eucalyptus grandis] Length = 626 Score = 55.1 bits (131), Expect = 3e-06 Identities = 22/31 (70%), Positives = 27/31 (87%) Frame = +2 Query: 32 RTHYSRDIQMTRHHNHGNTHTAVEDGPVLLS 124 RTH+SRDIQ+ RHHNHG+ H+A E+GP LLS Sbjct: 596 RTHFSRDIQLARHHNHGHAHSATENGPSLLS 626 >dbj|GAU23619.1| hypothetical protein TSUD_386080 [Trifolium subterraneum] Length = 608 Score = 53.9 bits (128), Expect = 7e-06 Identities = 22/30 (73%), Positives = 27/30 (90%) Frame = +2 Query: 32 RTHYSRDIQMTRHHNHGNTHTAVEDGPVLL 121 RT +SRDIQMTRH+N+GN HTA E+GP+LL Sbjct: 577 RTQFSRDIQMTRHNNYGNAHTAAENGPILL 606 >gb|OIV91728.1| hypothetical protein TanjilG_26581 [Lupinus angustifolius] Length = 525 Score = 53.5 bits (127), Expect = 1e-05 Identities = 24/32 (75%), Positives = 29/32 (90%), Gaps = 1/32 (3%) Frame = +2 Query: 32 RTHYSRDIQMTRH-HNHGNTHTAVEDGPVLLS 124 RTH+SRDIQMTRH +NH N+HTA E+GP+LLS Sbjct: 494 RTHFSRDIQMTRHNNNHANSHTASENGPILLS 525 >ref|XP_011043422.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein kinase At2g14440 isoform X2 [Populus euphratica] Length = 596 Score = 53.5 bits (127), Expect = 1e-05 Identities = 22/31 (70%), Positives = 26/31 (83%) Frame = +2 Query: 32 RTHYSRDIQMTRHHNHGNTHTAVEDGPVLLS 124 RTH S DIQ+TRH+NHGN TA E+GP+LLS Sbjct: 566 RTHLSHDIQLTRHYNHGNARTAAENGPILLS 596 >gb|KYP39538.1| Receptor-like protein kinase At5g59670 family [Cajanus cajan] Length = 612 Score = 53.5 bits (127), Expect = 1e-05 Identities = 24/32 (75%), Positives = 29/32 (90%), Gaps = 1/32 (3%) Frame = +2 Query: 32 RTHYSRDIQMTRHHNH-GNTHTAVEDGPVLLS 124 RTH+SRDIQMTRHHN+ G T+TA E+GP+LLS Sbjct: 581 RTHFSRDIQMTRHHNNQGKTYTAAENGPILLS 612 >ref|XP_016180684.1| putative leucine-rich repeat receptor-like serine/threonine-protein kinase At2g14440 [Arachis ipaensis] ref|XP_016180685.1| putative leucine-rich repeat receptor-like serine/threonine-protein kinase At2g14440 [Arachis ipaensis] ref|XP_016180686.1| putative leucine-rich repeat receptor-like serine/threonine-protein kinase At2g14440 [Arachis ipaensis] ref|XP_020970563.1| putative leucine-rich repeat receptor-like serine/threonine-protein kinase At2g14440 [Arachis ipaensis] Length = 623 Score = 53.5 bits (127), Expect = 1e-05 Identities = 22/31 (70%), Positives = 28/31 (90%) Frame = +2 Query: 32 RTHYSRDIQMTRHHNHGNTHTAVEDGPVLLS 124 RT +SRDIQMTRH+++GN HTA E+GP+LLS Sbjct: 593 RTQFSRDIQMTRHNSYGNAHTAAENGPILLS 623 >ref|XP_015943060.1| putative leucine-rich repeat receptor-like serine/threonine-protein kinase At2g14440 [Arachis duranensis] ref|XP_015943061.1| putative leucine-rich repeat receptor-like serine/threonine-protein kinase At2g14440 [Arachis duranensis] ref|XP_015943062.1| putative leucine-rich repeat receptor-like serine/threonine-protein kinase At2g14440 [Arachis duranensis] ref|XP_020989395.1| putative leucine-rich repeat receptor-like serine/threonine-protein kinase At2g14440 [Arachis duranensis] Length = 623 Score = 53.5 bits (127), Expect = 1e-05 Identities = 22/31 (70%), Positives = 28/31 (90%) Frame = +2 Query: 32 RTHYSRDIQMTRHHNHGNTHTAVEDGPVLLS 124 RT +SRDIQMTRH+++GN HTA E+GP+LLS Sbjct: 593 RTQFSRDIQMTRHNSYGNAHTAAENGPILLS 623 >gb|PNT11968.1| hypothetical protein POPTR_011G056800v3 [Populus trichocarpa] Length = 624 Score = 53.5 bits (127), Expect = 1e-05 Identities = 22/31 (70%), Positives = 26/31 (83%) Frame = +2 Query: 32 RTHYSRDIQMTRHHNHGNTHTAVEDGPVLLS 124 RTH S DIQ+TRH+NHGN TA E+GP+LLS Sbjct: 594 RTHLSHDIQLTRHYNHGNARTAAENGPILLS 624 >ref|XP_020203002.1| putative leucine-rich repeat receptor-like serine/threonine-protein kinase At2g14440 [Cajanus cajan] Length = 624 Score = 53.5 bits (127), Expect = 1e-05 Identities = 24/32 (75%), Positives = 29/32 (90%), Gaps = 1/32 (3%) Frame = +2 Query: 32 RTHYSRDIQMTRHHNH-GNTHTAVEDGPVLLS 124 RTH+SRDIQMTRHHN+ G T+TA E+GP+LLS Sbjct: 593 RTHFSRDIQMTRHHNNQGKTYTAAENGPILLS 624 >ref|XP_011043421.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein kinase At2g14440 isoform X1 [Populus euphratica] Length = 624 Score = 53.5 bits (127), Expect = 1e-05 Identities = 22/31 (70%), Positives = 26/31 (83%) Frame = +2 Query: 32 RTHYSRDIQMTRHHNHGNTHTAVEDGPVLLS 124 RTH S DIQ+TRH+NHGN TA E+GP+LLS Sbjct: 594 RTHLSHDIQLTRHYNHGNARTAAENGPILLS 624 >ref|XP_019425561.1| PREDICTED: receptor-like protein kinase At3g21340 [Lupinus angustifolius] Length = 626 Score = 53.5 bits (127), Expect = 1e-05 Identities = 24/32 (75%), Positives = 29/32 (90%), Gaps = 1/32 (3%) Frame = +2 Query: 32 RTHYSRDIQMTRH-HNHGNTHTAVEDGPVLLS 124 RTH+SRDIQMTRH +NH N+HTA E+GP+LLS Sbjct: 595 RTHFSRDIQMTRHNNNHANSHTASENGPILLS 626