BLASTX nr result
ID: Astragalus23_contig00022274
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus23_contig00022274 (447 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012569591.1| PREDICTED: pentatricopeptide repeat-containi... 76 4e-13 dbj|GAU13710.1| hypothetical protein TSUD_348140 [Trifolium subt... 72 4e-12 gb|KRG97246.1| hypothetical protein GLYMA_19G260300, partial [Gl... 72 1e-11 gb|KHN11371.1| Pentatricopeptide repeat-containing protein, mito... 72 1e-11 ref|XP_007139019.1| hypothetical protein PHAVU_009G258200g, part... 71 1e-11 ref|XP_014629547.1| PREDICTED: LOW QUALITY PROTEIN: conserved ol... 71 2e-11 ref|XP_003626608.1| PPR containing plant-like protein [Medicago ... 71 2e-11 gb|KHN16401.1| Pentatricopeptide repeat-containing protein, mito... 70 3e-11 ref|XP_014499093.1| pentatricopeptide repeat-containing protein ... 70 5e-11 gb|KYP71998.1| hypothetical protein KK1_011285 [Cajanus cajan] 68 2e-10 ref|XP_020212988.1| conserved oligomeric Golgi complex subunit 4... 68 2e-10 ref|XP_017409802.1| PREDICTED: pentatricopeptide repeat-containi... 67 3e-10 gb|OIW13510.1| hypothetical protein TanjilG_29251 [Lupinus angus... 66 9e-10 ref|XP_019438922.1| PREDICTED: conserved oligomeric Golgi comple... 66 1e-09 gb|PNX71594.1| pentatricopeptide repeat-containing protein mitoc... 64 4e-09 ref|XP_016170831.1| pentatricopeptide repeat-containing protein ... 62 3e-08 ref|XP_020973683.1| pentatricopeptide repeat-containing protein ... 62 3e-08 ref|XP_020983964.1| pentatricopeptide repeat-containing protein ... 62 3e-08 ref|XP_020968520.1| pentatricopeptide repeat-containing protein ... 62 3e-08 ref|XP_016180495.1| pentatricopeptide repeat-containing protein ... 62 3e-08 >ref|XP_012569591.1| PREDICTED: pentatricopeptide repeat-containing protein At4g01400, mitochondrial-like [Cicer arietinum] Length = 462 Score = 75.9 bits (185), Expect = 4e-13 Identities = 38/42 (90%), Positives = 41/42 (97%) Frame = -1 Query: 447 VKIGGVLEEVLKIEIKGHTRIVDAGIGLENYLIGKIRAKSRK 322 +KIGGVLEEVLKIEIKGHTRIVDAGIGLE+YLI KIRAKSR+ Sbjct: 420 LKIGGVLEEVLKIEIKGHTRIVDAGIGLEDYLIRKIRAKSRQ 461 >dbj|GAU13710.1| hypothetical protein TSUD_348140 [Trifolium subterraneum] Length = 341 Score = 72.4 bits (176), Expect = 4e-12 Identities = 37/42 (88%), Positives = 40/42 (95%) Frame = -1 Query: 447 VKIGGVLEEVLKIEIKGHTRIVDAGIGLENYLIGKIRAKSRK 322 VKIGGVLEEVLKIEIKG TRI+DAGIGLE+YLI KIRAKSR+ Sbjct: 299 VKIGGVLEEVLKIEIKGDTRIMDAGIGLEDYLIRKIRAKSRQ 340 >gb|KRG97246.1| hypothetical protein GLYMA_19G260300, partial [Glycine max] Length = 383 Score = 71.6 bits (174), Expect = 1e-11 Identities = 35/40 (87%), Positives = 37/40 (92%) Frame = -1 Query: 444 KIGGVLEEVLKIEIKGHTRIVDAGIGLENYLIGKIRAKSR 325 K G LEEVLKIEIKGHTRIVDAGIGLENYLIGKIR++SR Sbjct: 342 KSSGALEEVLKIEIKGHTRIVDAGIGLENYLIGKIRSRSR 381 >gb|KHN11371.1| Pentatricopeptide repeat-containing protein, mitochondrial [Glycine soja] Length = 400 Score = 71.6 bits (174), Expect = 1e-11 Identities = 35/40 (87%), Positives = 37/40 (92%) Frame = -1 Query: 444 KIGGVLEEVLKIEIKGHTRIVDAGIGLENYLIGKIRAKSR 325 K G LEEVLKIEIKGHTRIVDAGIGLENYLIGKIR++SR Sbjct: 359 KSSGALEEVLKIEIKGHTRIVDAGIGLENYLIGKIRSRSR 398 >ref|XP_007139019.1| hypothetical protein PHAVU_009G258200g, partial [Phaseolus vulgaris] gb|ESW11013.1| hypothetical protein PHAVU_009G258200g, partial [Phaseolus vulgaris] Length = 418 Score = 71.2 bits (173), Expect = 1e-11 Identities = 36/40 (90%), Positives = 36/40 (90%) Frame = -1 Query: 444 KIGGVLEEVLKIEIKGHTRIVDAGIGLENYLIGKIRAKSR 325 KI G LEEVLKIEIKGHTRIVDAGIGLENYLI KIRA SR Sbjct: 377 KISGALEEVLKIEIKGHTRIVDAGIGLENYLIKKIRANSR 416 >ref|XP_014629547.1| PREDICTED: LOW QUALITY PROTEIN: conserved oligomeric Golgi complex subunit 4-like [Glycine max] Length = 1220 Score = 71.2 bits (173), Expect = 2e-11 Identities = 35/41 (85%), Positives = 37/41 (90%) Frame = -1 Query: 444 KIGGVLEEVLKIEIKGHTRIVDAGIGLENYLIGKIRAKSRK 322 KI G LEEVLKIEIKGHTRIVD GIGLENYLI KIRA+S+K Sbjct: 426 KISGALEEVLKIEIKGHTRIVDVGIGLENYLIRKIRARSKK 466 >ref|XP_003626608.1| PPR containing plant-like protein [Medicago truncatula] gb|ABD32710.1| Tetratricopeptide-like helical [Medicago truncatula] gb|AES82826.1| PPR containing plant-like protein [Medicago truncatula] Length = 451 Score = 70.9 bits (172), Expect = 2e-11 Identities = 37/42 (88%), Positives = 39/42 (92%) Frame = -1 Query: 447 VKIGGVLEEVLKIEIKGHTRIVDAGIGLENYLIGKIRAKSRK 322 VKI GVLEEVLKIEIKG TRIVDAGIGLE+YLI KIRAKSR+ Sbjct: 409 VKIDGVLEEVLKIEIKGDTRIVDAGIGLEDYLIRKIRAKSRQ 450 >gb|KHN16401.1| Pentatricopeptide repeat-containing protein, mitochondrial [Glycine soja] gb|KRH68962.1| hypothetical protein GLYMA_03G261200 [Glycine max] Length = 466 Score = 70.5 bits (171), Expect = 3e-11 Identities = 35/40 (87%), Positives = 36/40 (90%) Frame = -1 Query: 444 KIGGVLEEVLKIEIKGHTRIVDAGIGLENYLIGKIRAKSR 325 KI G LEEVLKIEIKGHTRIVD GIGLENYLI KIRA+SR Sbjct: 426 KISGALEEVLKIEIKGHTRIVDVGIGLENYLIRKIRARSR 465 >ref|XP_014499093.1| pentatricopeptide repeat-containing protein At4g01400, mitochondrial [Vigna radiata var. radiata] Length = 457 Score = 69.7 bits (169), Expect = 5e-11 Identities = 35/41 (85%), Positives = 36/41 (87%) Frame = -1 Query: 444 KIGGVLEEVLKIEIKGHTRIVDAGIGLENYLIGKIRAKSRK 322 KI G LEEVLKIEIKGHTRIVDAGIGLENYLI KIRA S + Sbjct: 415 KINGTLEEVLKIEIKGHTRIVDAGIGLENYLIRKIRANSTR 455 >gb|KYP71998.1| hypothetical protein KK1_011285 [Cajanus cajan] Length = 390 Score = 68.2 bits (165), Expect = 2e-10 Identities = 34/41 (82%), Positives = 37/41 (90%) Frame = -1 Query: 447 VKIGGVLEEVLKIEIKGHTRIVDAGIGLENYLIGKIRAKSR 325 V+IG LEEVLKIEIKGHTRIVDAGIGLENYLI KI++ SR Sbjct: 348 VRIGEALEEVLKIEIKGHTRIVDAGIGLENYLIRKIQSNSR 388 >ref|XP_020212988.1| conserved oligomeric Golgi complex subunit 4 [Cajanus cajan] Length = 1198 Score = 68.2 bits (165), Expect = 2e-10 Identities = 34/41 (82%), Positives = 37/41 (90%) Frame = -1 Query: 447 VKIGGVLEEVLKIEIKGHTRIVDAGIGLENYLIGKIRAKSR 325 V+IG LEEVLKIEIKGHTRIVDAGIGLENYLI KI++ SR Sbjct: 420 VRIGEALEEVLKIEIKGHTRIVDAGIGLENYLIRKIQSNSR 460 >ref|XP_017409802.1| PREDICTED: pentatricopeptide repeat-containing protein At4g01400, mitochondrial-like [Vigna angularis] gb|KOM29127.1| hypothetical protein LR48_Vigan635s005200 [Vigna angularis] Length = 457 Score = 67.4 bits (163), Expect = 3e-10 Identities = 34/41 (82%), Positives = 35/41 (85%) Frame = -1 Query: 444 KIGGVLEEVLKIEIKGHTRIVDAGIGLENYLIGKIRAKSRK 322 KI G LEEVL IEIKGHTRIVDAGIGLENYLI KIRA S + Sbjct: 415 KISGALEEVLMIEIKGHTRIVDAGIGLENYLIRKIRANSTR 455 >gb|OIW13510.1| hypothetical protein TanjilG_29251 [Lupinus angustifolius] gb|OIW22003.1| hypothetical protein TanjilG_28546 [Lupinus angustifolius] Length = 460 Score = 66.2 bits (160), Expect = 9e-10 Identities = 32/40 (80%), Positives = 36/40 (90%) Frame = -1 Query: 444 KIGGVLEEVLKIEIKGHTRIVDAGIGLENYLIGKIRAKSR 325 KI ++E+LKIEIKGHTRIVDAGIGLENYLI KI+AKSR Sbjct: 419 KISEAIDEILKIEIKGHTRIVDAGIGLENYLIRKIQAKSR 458 >ref|XP_019438922.1| PREDICTED: conserved oligomeric Golgi complex subunit 4-like [Lupinus angustifolius] Length = 1207 Score = 66.2 bits (160), Expect = 1e-09 Identities = 32/40 (80%), Positives = 36/40 (90%) Frame = -1 Query: 444 KIGGVLEEVLKIEIKGHTRIVDAGIGLENYLIGKIRAKSR 325 KI ++E+LKIEIKGHTRIVDAGIGLENYLI KI+AKSR Sbjct: 419 KISEAIDEILKIEIKGHTRIVDAGIGLENYLIRKIQAKSR 458 >gb|PNX71594.1| pentatricopeptide repeat-containing protein mitochondrial-like [Trifolium pratense] Length = 460 Score = 64.3 bits (155), Expect = 4e-09 Identities = 33/37 (89%), Positives = 35/37 (94%) Frame = -1 Query: 432 VLEEVLKIEIKGHTRIVDAGIGLENYLIGKIRAKSRK 322 VLEEVLKIEIKG TRIVDAGIGLE+YLI KIRAK+RK Sbjct: 423 VLEEVLKIEIKGDTRIVDAGIGLEDYLIRKIRAKTRK 459 >ref|XP_016170831.1| pentatricopeptide repeat-containing protein At4g01400, mitochondrial-like [Arachis ipaensis] Length = 459 Score = 62.0 bits (149), Expect = 3e-08 Identities = 32/41 (78%), Positives = 34/41 (82%) Frame = -1 Query: 447 VKIGGVLEEVLKIEIKGHTRIVDAGIGLENYLIGKIRAKSR 325 V+ VLE+VLKIEI GHTRIVDAGIGLENYLI KIRA R Sbjct: 417 VRSRDVLEQVLKIEITGHTRIVDAGIGLENYLIRKIRANPR 457 >ref|XP_020973683.1| pentatricopeptide repeat-containing protein At4g01400, mitochondrial-like [Arachis ipaensis] ref|XP_020973685.1| pentatricopeptide repeat-containing protein At4g01400, mitochondrial-like [Arachis ipaensis] Length = 459 Score = 62.0 bits (149), Expect = 3e-08 Identities = 32/41 (78%), Positives = 34/41 (82%) Frame = -1 Query: 447 VKIGGVLEEVLKIEIKGHTRIVDAGIGLENYLIGKIRAKSR 325 V+ VLE+VLKIEI GHTRIVDAGIGLENYLI KIRA R Sbjct: 417 VRSRDVLEQVLKIEITGHTRIVDAGIGLENYLIRKIRANPR 457 >ref|XP_020983964.1| pentatricopeptide repeat-containing protein At4g01400, mitochondrial-like [Arachis duranensis] Length = 459 Score = 62.0 bits (149), Expect = 3e-08 Identities = 32/41 (78%), Positives = 34/41 (82%) Frame = -1 Query: 447 VKIGGVLEEVLKIEIKGHTRIVDAGIGLENYLIGKIRAKSR 325 V+ VLE+VLKIEI GHTRIVDAGIGLENYLI KIRA R Sbjct: 417 VRSRDVLEQVLKIEITGHTRIVDAGIGLENYLIRKIRANPR 457 >ref|XP_020968520.1| pentatricopeptide repeat-containing protein At4g01400, mitochondrial-like isoform X2 [Arachis ipaensis] Length = 407 Score = 61.6 bits (148), Expect = 3e-08 Identities = 31/36 (86%), Positives = 32/36 (88%) Frame = -1 Query: 432 VLEEVLKIEIKGHTRIVDAGIGLENYLIGKIRAKSR 325 VLE+VLKIEI GHTRIVDAGIGLENYLI KIRA R Sbjct: 370 VLEQVLKIEITGHTRIVDAGIGLENYLIRKIRANPR 405 >ref|XP_016180495.1| pentatricopeptide repeat-containing protein At4g01400, mitochondrial-like isoform X1 [Arachis ipaensis] Length = 459 Score = 61.6 bits (148), Expect = 3e-08 Identities = 31/36 (86%), Positives = 32/36 (88%) Frame = -1 Query: 432 VLEEVLKIEIKGHTRIVDAGIGLENYLIGKIRAKSR 325 VLE+VLKIEI GHTRIVDAGIGLENYLI KIRA R Sbjct: 422 VLEQVLKIEITGHTRIVDAGIGLENYLIRKIRANPR 457