BLASTX nr result
ID: Astragalus23_contig00022232
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus23_contig00022232 (456 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_013469454.1| armadillo/beta-catenin repeat protein [Medic... 66 1e-09 ref|XP_013469455.1| armadillo/beta-catenin repeat protein [Medic... 66 1e-09 gb|POF24672.1| u-box domain-containing protein 14 [Quercus suber] 60 7e-09 gb|PNX69583.1| U-box domain-containing protein 14-like, partial ... 60 9e-09 ref|XP_004496239.1| PREDICTED: U-box domain-containing protein 1... 63 2e-08 gb|PNX61172.1| U-box domain-containing protein 14-like [Trifoliu... 60 3e-08 gb|POF24671.1| isoform 2 of u-box domain-containing protein 12 [... 60 4e-08 gb|PON38069.1| Beta-catenin [Trema orientalis] 62 4e-08 gb|PON36546.1| Beta-catenin [Parasponia andersonii] 62 4e-08 gb|ATP84482.1| ARC1 [Corylus heterophylla x Corylus avellana] 61 7e-08 dbj|GAU31273.1| hypothetical protein TSUD_39530 [Trifolium subte... 61 7e-08 ref|XP_016175885.1| U-box domain-containing protein 14 [Arachis ... 61 7e-08 ref|XP_019434382.1| PREDICTED: U-box domain-containing protein 1... 60 1e-07 gb|PNX95817.1| U-box domain-containing protein 14-like [Trifoliu... 60 1e-07 ref|XP_023924896.1| U-box domain-containing protein 14-like [Que... 60 1e-07 gb|EEF32796.1| E3 ubiquitin ligase PUB14, putative [Ricinus comm... 60 1e-07 ref|XP_002529604.2| PREDICTED: U-box domain-containing protein 1... 60 1e-07 gb|POF24667.1| u-box domain-containing protein 14 [Quercus suber] 60 1e-07 gb|POE65797.1| u-box domain-containing protein 14 [Quercus suber] 60 1e-07 ref|XP_023888770.1| U-box domain-containing protein 14-like [Que... 60 1e-07 >ref|XP_013469454.1| armadillo/beta-catenin repeat protein [Medicago truncatula] gb|KEH43492.1| armadillo/beta-catenin repeat protein [Medicago truncatula] Length = 447 Score = 65.9 bits (159), Expect = 1e-09 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 6/49 (12%) Frame = +3 Query: 327 EPTP------RTGSPRNRENDAVVSWLMCTGDLLQLKLLKEPGAKEALR 455 EP P RTGSPRNREN A V WL+CTGDLLQLKL KE GA+EAL+ Sbjct: 366 EPIPILVEVIRTGSPRNRENAAAVLWLVCTGDLLQLKLAKEHGAEEALQ 414 >ref|XP_013469455.1| armadillo/beta-catenin repeat protein [Medicago truncatula] gb|KEH43493.1| armadillo/beta-catenin repeat protein [Medicago truncatula] Length = 630 Score = 65.9 bits (159), Expect = 1e-09 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 6/49 (12%) Frame = +3 Query: 327 EPTP------RTGSPRNRENDAVVSWLMCTGDLLQLKLLKEPGAKEALR 455 EP P RTGSPRNREN A V WL+CTGDLLQLKL KE GA+EAL+ Sbjct: 549 EPIPILVEVIRTGSPRNRENAAAVLWLVCTGDLLQLKLAKEHGAEEALQ 597 >gb|POF24672.1| u-box domain-containing protein 14 [Quercus suber] Length = 106 Score = 60.1 bits (144), Expect = 7e-09 Identities = 31/49 (63%), Positives = 34/49 (69%), Gaps = 6/49 (12%) Frame = +3 Query: 327 EPTP------RTGSPRNRENDAVVSWLMCTGDLLQLKLLKEPGAKEALR 455 EP P RTGSPRNREN A V W +CTGD QLKL KE GA+EAL+ Sbjct: 26 EPIPVLVEVIRTGSPRNRENSAAVLWSLCTGDFEQLKLSKELGAEEALK 74 >gb|PNX69583.1| U-box domain-containing protein 14-like, partial [Trifolium pratense] Length = 132 Score = 60.5 bits (145), Expect = 9e-09 Identities = 29/39 (74%), Positives = 31/39 (79%) Frame = +3 Query: 339 RTGSPRNRENDAVVSWLMCTGDLLQLKLLKEPGAKEALR 455 RTGSPRNREN A V W +CTGD LQLKL KE GA EAL+ Sbjct: 61 RTGSPRNRENAAAVLWSVCTGDFLQLKLAKEHGAVEALQ 99 >ref|XP_004496239.1| PREDICTED: U-box domain-containing protein 14 [Cicer arietinum] Length = 630 Score = 62.8 bits (151), Expect = 2e-08 Identities = 32/49 (65%), Positives = 36/49 (73%), Gaps = 6/49 (12%) Frame = +3 Query: 327 EPTP------RTGSPRNRENDAVVSWLMCTGDLLQLKLLKEPGAKEALR 455 EP P RTGSPRNREN A V W +CTGDL+QLKL KE GA+EAL+ Sbjct: 549 EPIPVLVEVIRTGSPRNRENAAAVLWSVCTGDLMQLKLAKEHGAEEALQ 597 >gb|PNX61172.1| U-box domain-containing protein 14-like [Trifolium pratense] Length = 191 Score = 60.5 bits (145), Expect = 3e-08 Identities = 29/39 (74%), Positives = 31/39 (79%) Frame = +3 Query: 339 RTGSPRNRENDAVVSWLMCTGDLLQLKLLKEPGAKEALR 455 RTGSPRNREN A V W +CTGD LQLKL KE GA EAL+ Sbjct: 120 RTGSPRNRENAAAVLWSVCTGDFLQLKLAKEHGAVEALQ 158 >gb|POF24671.1| isoform 2 of u-box domain-containing protein 12 [Quercus suber] Length = 190 Score = 60.1 bits (144), Expect = 4e-08 Identities = 31/49 (63%), Positives = 34/49 (69%), Gaps = 6/49 (12%) Frame = +3 Query: 327 EPTP------RTGSPRNRENDAVVSWLMCTGDLLQLKLLKEPGAKEALR 455 EP P RTGSPRNREN A V W +CTGD QLKL KE GA+EAL+ Sbjct: 110 EPIPVLVEVIRTGSPRNRENSAAVLWSLCTGDFEQLKLSKELGAEEALK 158 >gb|PON38069.1| Beta-catenin [Trema orientalis] Length = 623 Score = 61.6 bits (148), Expect = 4e-08 Identities = 32/49 (65%), Positives = 35/49 (71%), Gaps = 6/49 (12%) Frame = +3 Query: 327 EPTP------RTGSPRNRENDAVVSWLMCTGDLLQLKLLKEPGAKEALR 455 EP P RTGSPRNREN A V W +CTGDL QLKL KE GA+EAL+ Sbjct: 547 EPIPVLVEVIRTGSPRNRENAAAVLWSLCTGDLQQLKLAKELGAEEALK 595 >gb|PON36546.1| Beta-catenin [Parasponia andersonii] Length = 623 Score = 61.6 bits (148), Expect = 4e-08 Identities = 32/49 (65%), Positives = 35/49 (71%), Gaps = 6/49 (12%) Frame = +3 Query: 327 EPTP------RTGSPRNRENDAVVSWLMCTGDLLQLKLLKEPGAKEALR 455 EP P RTGSPRNREN A V W +CTGDL QLKL KE GA+EAL+ Sbjct: 547 EPIPVLVEVIRTGSPRNRENAAAVLWSLCTGDLQQLKLAKELGAEEALK 595 >gb|ATP84482.1| ARC1 [Corylus heterophylla x Corylus avellana] Length = 628 Score = 60.8 bits (146), Expect = 7e-08 Identities = 28/39 (71%), Positives = 32/39 (82%) Frame = +3 Query: 339 RTGSPRNRENDAVVSWLMCTGDLLQLKLLKEPGAKEALR 455 RTGSPRNREN A V W +CTGDL QLKL +E GA+EAL+ Sbjct: 559 RTGSPRNRENSAAVLWSLCTGDLEQLKLAREVGAEEALK 597 >dbj|GAU31273.1| hypothetical protein TSUD_39530 [Trifolium subterraneum] Length = 630 Score = 60.8 bits (146), Expect = 7e-08 Identities = 32/49 (65%), Positives = 34/49 (69%), Gaps = 6/49 (12%) Frame = +3 Query: 327 EPTP------RTGSPRNRENDAVVSWLMCTGDLLQLKLLKEPGAKEALR 455 EP P RTGSPRNREN A V W +CTGD LQLKL KE GA EAL+ Sbjct: 549 EPIPILVEVIRTGSPRNRENAAAVLWSVCTGDFLQLKLAKEHGAVEALQ 597 >ref|XP_016175885.1| U-box domain-containing protein 14 [Arachis ipaensis] Length = 635 Score = 60.8 bits (146), Expect = 7e-08 Identities = 31/48 (64%), Positives = 34/48 (70%), Gaps = 6/48 (12%) Frame = +3 Query: 327 EPTP------RTGSPRNRENDAVVSWLMCTGDLLQLKLLKEPGAKEAL 452 EP P RTGSPRNREN A V W +CTGDL+QLKL KE GA+E L Sbjct: 554 EPIPILVEVIRTGSPRNRENAAAVLWSLCTGDLMQLKLAKELGAEEVL 601 >ref|XP_019434382.1| PREDICTED: U-box domain-containing protein 14 [Lupinus angustifolius] gb|OIV89563.1| hypothetical protein TanjilG_19240 [Lupinus angustifolius] Length = 629 Score = 60.5 bits (145), Expect = 1e-07 Identities = 32/48 (66%), Positives = 34/48 (70%), Gaps = 6/48 (12%) Frame = +3 Query: 327 EPTP------RTGSPRNRENDAVVSWLMCTGDLLQLKLLKEPGAKEAL 452 EP P RTGSPRNREN A V W +CTGDLLQLKL K GA+EAL Sbjct: 547 EPIPVVIEVIRTGSPRNRENAAAVLWSLCTGDLLQLKLAKGLGAEEAL 594 >gb|PNX95817.1| U-box domain-containing protein 14-like [Trifolium pratense] Length = 653 Score = 60.5 bits (145), Expect = 1e-07 Identities = 29/39 (74%), Positives = 31/39 (79%) Frame = +3 Query: 339 RTGSPRNRENDAVVSWLMCTGDLLQLKLLKEPGAKEALR 455 RTGSPRNREN A V W +CTGD LQLKL KE GA EAL+ Sbjct: 582 RTGSPRNRENAAAVLWSVCTGDFLQLKLAKEHGAVEALQ 620 >ref|XP_023924896.1| U-box domain-containing protein 14-like [Quercus suber] Length = 311 Score = 60.1 bits (144), Expect = 1e-07 Identities = 31/49 (63%), Positives = 34/49 (69%), Gaps = 6/49 (12%) Frame = +3 Query: 327 EPTP------RTGSPRNRENDAVVSWLMCTGDLLQLKLLKEPGAKEALR 455 EP P RTGSPRNREN A V W +CTGD QLKL KE GA+EAL+ Sbjct: 231 EPIPVLVEVIRTGSPRNRENSAAVLWSLCTGDFEQLKLSKELGAEEALK 279 >gb|EEF32796.1| E3 ubiquitin ligase PUB14, putative [Ricinus communis] Length = 575 Score = 60.1 bits (144), Expect = 1e-07 Identities = 28/39 (71%), Positives = 31/39 (79%) Frame = +3 Query: 339 RTGSPRNRENDAVVSWLMCTGDLLQLKLLKEPGAKEALR 455 RTGSPRNREN A V W +C GDL QLKL KE GA+EAL+ Sbjct: 504 RTGSPRNRENAAAVLWSLCAGDLQQLKLAKESGAEEALK 542 >ref|XP_002529604.2| PREDICTED: U-box domain-containing protein 14 [Ricinus communis] Length = 578 Score = 60.1 bits (144), Expect = 1e-07 Identities = 28/39 (71%), Positives = 31/39 (79%) Frame = +3 Query: 339 RTGSPRNRENDAVVSWLMCTGDLLQLKLLKEPGAKEALR 455 RTGSPRNREN A V W +C GDL QLKL KE GA+EAL+ Sbjct: 507 RTGSPRNRENAAAVLWSLCAGDLQQLKLAKESGAEEALK 545 >gb|POF24667.1| u-box domain-containing protein 14 [Quercus suber] Length = 631 Score = 60.1 bits (144), Expect = 1e-07 Identities = 31/49 (63%), Positives = 34/49 (69%), Gaps = 6/49 (12%) Frame = +3 Query: 327 EPTP------RTGSPRNRENDAVVSWLMCTGDLLQLKLLKEPGAKEALR 455 EP P RTGSPRNREN A V W +CTGD QLKL KE GA+EAL+ Sbjct: 552 EPIPVLVEVIRTGSPRNRENSAAVLWSLCTGDFEQLKLSKELGAEEALK 600 >gb|POE65797.1| u-box domain-containing protein 14 [Quercus suber] Length = 631 Score = 60.1 bits (144), Expect = 1e-07 Identities = 31/49 (63%), Positives = 34/49 (69%), Gaps = 6/49 (12%) Frame = +3 Query: 327 EPTP------RTGSPRNRENDAVVSWLMCTGDLLQLKLLKEPGAKEALR 455 EP P RTGSPRNREN A V W +CTGD QLKL KE GA+EAL+ Sbjct: 552 EPIPVLVEVIRTGSPRNRENSAAVLWSLCTGDFEQLKLSKELGAEEALK 600 >ref|XP_023888770.1| U-box domain-containing protein 14-like [Quercus suber] Length = 632 Score = 60.1 bits (144), Expect = 1e-07 Identities = 31/49 (63%), Positives = 34/49 (69%), Gaps = 6/49 (12%) Frame = +3 Query: 327 EPTP------RTGSPRNRENDAVVSWLMCTGDLLQLKLLKEPGAKEALR 455 EP P RTGSPRNREN A V W +CTGD QLKL KE GA+EAL+ Sbjct: 552 EPIPVLVEVIRTGSPRNRENSAAVLWSLCTGDFEQLKLSKELGAEEALK 600