BLASTX nr result
ID: Astragalus23_contig00022227
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus23_contig00022227 (625 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KRH75501.1| hypothetical protein GLYMA_01G088400 [Glycine max] 60 2e-09 >gb|KRH75501.1| hypothetical protein GLYMA_01G088400 [Glycine max] Length = 142 Score = 60.1 bits (144), Expect(2) = 2e-09 Identities = 32/52 (61%), Positives = 37/52 (71%) Frame = -3 Query: 599 YIHR*SHIRLPQFTRKHHVSKKSFNIN*ETMQREKLRTLIP*SKLKPFE*QS 444 Y+HR S IRLP TRKH + KKSF+IN E+ RE L TLI +K KPFE QS Sbjct: 61 YMHRQSQIRLPWSTRKHQMPKKSFDINYESTHRENLGTLITWNKQKPFEQQS 112 Score = 30.4 bits (67), Expect(2) = 2e-09 Identities = 13/19 (68%), Positives = 16/19 (84%) Frame = -1 Query: 436 NQGNSILSKEPKTKIESIP 380 N+GN IL+KEPK K E+IP Sbjct: 115 NEGNPILNKEPKFKKENIP 133