BLASTX nr result
ID: Astragalus23_contig00022187
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus23_contig00022187 (361 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KOM46041.1| hypothetical protein LR48_Vigan06g134700 [Vigna a... 54 2e-06 ref|XP_007153424.1| hypothetical protein PHAVU_003G034100g [Phas... 55 2e-06 >gb|KOM46041.1| hypothetical protein LR48_Vigan06g134700 [Vigna angularis] Length = 132 Score = 53.5 bits (127), Expect = 2e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +2 Query: 2 FSQSDRQLLDHISESLTQSQLNAIQMVLKR 91 FSQSDRQLL+HI ESLTQSQ NAIQM+LKR Sbjct: 103 FSQSDRQLLEHICESLTQSQRNAIQMILKR 132 >ref|XP_007153424.1| hypothetical protein PHAVU_003G034100g [Phaseolus vulgaris] gb|ESW25418.1| hypothetical protein PHAVU_003G034100g [Phaseolus vulgaris] Length = 1022 Score = 55.5 bits (132), Expect = 2e-06 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = +2 Query: 2 FSQSDRQLLDHISESLTQSQLNAIQMVLKR 91 FSQSDRQLLDHI ESLTQSQ NAIQMVLKR Sbjct: 993 FSQSDRQLLDHICESLTQSQQNAIQMVLKR 1022