BLASTX nr result
ID: Astragalus23_contig00022183
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus23_contig00022183 (410 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004494906.1| PREDICTED: probable 2-oxoglutarate/Fe(II)-de... 73 5e-13 gb|PNX99702.1| leucoanthocyanidin dioxygenase-like protein [Trif... 69 6e-12 ref|XP_006577713.2| PREDICTED: codeine O-demethylase-like [Glyci... 70 3e-11 gb|KHN18704.1| Codeine O-demethylase [Glycine soja] 70 3e-11 gb|AFK37442.1| unknown [Lotus japonicus] 69 6e-11 ref|XP_003625747.2| leucoanthocyanidin dioxygenase-like protein ... 69 6e-11 gb|OMO81906.1| Oxoglutarate/iron-dependent dioxygenase [Corchoru... 67 1e-10 gb|KHN48225.1| Putative 2-oxoglutarate/Fe(II)-dependent dioxygen... 68 2e-10 ref|XP_003541434.1| PREDICTED: 1-aminocyclopropane-1-carboxylate... 68 2e-10 ref|XP_003535233.1| PREDICTED: probable 2-oxoglutarate/Fe(II)-de... 68 2e-10 ref|XP_020213548.1| protein DMR6-LIKE OXYGENASE 1-like [Cajanus ... 67 2e-10 gb|OMO84038.1| Isopenicillin N synthase [Corchorus olitorius] 67 2e-10 ref|NP_001241598.1| uncharacterized protein LOC100778488 [Glycin... 67 4e-10 ref|XP_017409994.1| PREDICTED: protein DMR6-LIKE OXYGENASE 2-lik... 66 7e-10 ref|XP_007162817.1| hypothetical protein PHAVU_001G183300g [Phas... 66 7e-10 ref|XP_012567886.1| PREDICTED: probable 2-oxoglutarate/Fe(II)-de... 62 1e-09 ref|XP_020239054.1| protein DMR6-LIKE OXYGENASE 1-like [Cajanus ... 65 2e-09 ref|XP_014495649.1| protein DMR6-LIKE OXYGENASE 2 [Vigna radiata... 65 2e-09 ref|XP_014513105.1| protein DMR6-LIKE OXYGENASE 1 isoform X2 [Vi... 65 2e-09 ref|XP_017414293.1| PREDICTED: protein DMR6-LIKE OXYGENASE 1-lik... 65 2e-09 >ref|XP_004494906.1| PREDICTED: probable 2-oxoglutarate/Fe(II)-dependent dioxygenase [Cicer arietinum] Length = 204 Score = 72.8 bits (177), Expect = 5e-13 Identities = 35/38 (92%), Positives = 35/38 (92%) Frame = +1 Query: 1 IDEANPKRYMDTDFDSFLTYVSTREPKKKDFLESRKLI 114 IDEANPKRYMDTDF SFL YVSTRE KKKDFLESRKLI Sbjct: 165 IDEANPKRYMDTDFGSFLAYVSTRETKKKDFLESRKLI 202 >gb|PNX99702.1| leucoanthocyanidin dioxygenase-like protein [Trifolium pratense] Length = 175 Score = 69.3 bits (168), Expect = 6e-12 Identities = 33/37 (89%), Positives = 33/37 (89%) Frame = +1 Query: 1 IDEANPKRYMDTDFDSFLTYVSTREPKKKDFLESRKL 111 IDE NPKRYMDTDF SFL YVSTRE KKKDFLESRKL Sbjct: 138 IDEENPKRYMDTDFGSFLAYVSTRETKKKDFLESRKL 174 >ref|XP_006577713.2| PREDICTED: codeine O-demethylase-like [Glycine max] gb|KRH67790.1| hypothetical protein GLYMA_03G187900 [Glycine max] Length = 366 Score = 69.7 bits (169), Expect = 3e-11 Identities = 31/37 (83%), Positives = 35/37 (94%) Frame = +1 Query: 1 IDEANPKRYMDTDFDSFLTYVSTREPKKKDFLESRKL 111 +DEANPKRYMDTDF +FL YVS+REPKKKDFLESRK+ Sbjct: 327 VDEANPKRYMDTDFRTFLAYVSSREPKKKDFLESRKV 363 >gb|KHN18704.1| Codeine O-demethylase [Glycine soja] Length = 366 Score = 69.7 bits (169), Expect = 3e-11 Identities = 31/37 (83%), Positives = 35/37 (94%) Frame = +1 Query: 1 IDEANPKRYMDTDFDSFLTYVSTREPKKKDFLESRKL 111 +DEANPKRYMDTDF +FL YVS+REPKKKDFLESRK+ Sbjct: 327 VDEANPKRYMDTDFRTFLAYVSSREPKKKDFLESRKV 363 >gb|AFK37442.1| unknown [Lotus japonicus] Length = 379 Score = 68.9 bits (167), Expect = 6e-11 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = +1 Query: 1 IDEANPKRYMDTDFDSFLTYVSTREPKKKDFLESRKL 111 IDE NPKRYMDTDF++FL YVS+REPKKKDFL SRKL Sbjct: 339 IDEENPKRYMDTDFETFLAYVSSREPKKKDFLNSRKL 375 >ref|XP_003625747.2| leucoanthocyanidin dioxygenase-like protein [Medicago truncatula] gb|AES81965.2| leucoanthocyanidin dioxygenase-like protein [Medicago truncatula] Length = 383 Score = 68.9 bits (167), Expect = 6e-11 Identities = 33/37 (89%), Positives = 33/37 (89%) Frame = +1 Query: 1 IDEANPKRYMDTDFDSFLTYVSTREPKKKDFLESRKL 111 IDE NPKRYMDTDF SFL YVSTRE KKKDFLESRKL Sbjct: 344 IDEENPKRYMDTDFASFLAYVSTRETKKKDFLESRKL 380 >gb|OMO81906.1| Oxoglutarate/iron-dependent dioxygenase [Corchorus capsularis] Length = 285 Score = 67.4 bits (163), Expect = 1e-10 Identities = 30/37 (81%), Positives = 35/37 (94%) Frame = +1 Query: 1 IDEANPKRYMDTDFDSFLTYVSTREPKKKDFLESRKL 111 IDEANP+RYMDTDF +FL Y+S+REPKKK+FLESRKL Sbjct: 248 IDEANPRRYMDTDFATFLEYISSREPKKKNFLESRKL 284 >gb|KHN48225.1| Putative 2-oxoglutarate/Fe(II)-dependent dioxygenase [Glycine soja] Length = 381 Score = 67.8 bits (164), Expect = 2e-10 Identities = 30/37 (81%), Positives = 35/37 (94%) Frame = +1 Query: 1 IDEANPKRYMDTDFDSFLTYVSTREPKKKDFLESRKL 111 IDEANPKRY DT+FD+FL YVSTREPK+K+FL+SRKL Sbjct: 342 IDEANPKRYADTNFDTFLAYVSTREPKRKEFLDSRKL 378 >ref|XP_003541434.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase 5-like [Glycine max] gb|KRH19976.1| hypothetical protein GLYMA_13G147600 [Glycine max] Length = 381 Score = 67.8 bits (164), Expect = 2e-10 Identities = 30/37 (81%), Positives = 35/37 (94%) Frame = +1 Query: 1 IDEANPKRYMDTDFDSFLTYVSTREPKKKDFLESRKL 111 IDEANPKRY DT+FD+FL YVSTREPK+K+FL+SRKL Sbjct: 342 IDEANPKRYADTNFDTFLAYVSTREPKRKEFLDSRKL 378 >ref|XP_003535233.1| PREDICTED: probable 2-oxoglutarate/Fe(II)-dependent dioxygenase [Glycine max] gb|KRH32602.1| hypothetical protein GLYMA_10G063000 [Glycine max] Length = 382 Score = 67.8 bits (164), Expect = 2e-10 Identities = 30/37 (81%), Positives = 35/37 (94%) Frame = +1 Query: 1 IDEANPKRYMDTDFDSFLTYVSTREPKKKDFLESRKL 111 IDEANPKRY DT+FD+FL YVSTREPK+K+FL+SRKL Sbjct: 343 IDEANPKRYADTNFDTFLAYVSTREPKRKEFLDSRKL 379 >ref|XP_020213548.1| protein DMR6-LIKE OXYGENASE 1-like [Cajanus cajan] gb|KYP70976.1| Protein SRG1 [Cajanus cajan] Length = 369 Score = 67.4 bits (163), Expect = 2e-10 Identities = 31/37 (83%), Positives = 33/37 (89%) Frame = +1 Query: 1 IDEANPKRYMDTDFDSFLTYVSTREPKKKDFLESRKL 111 +DEANPKRYMDTDF SFL YVS+RE KKDFLESRKL Sbjct: 331 VDEANPKRYMDTDFGSFLAYVSSRESNKKDFLESRKL 367 >gb|OMO84038.1| Isopenicillin N synthase [Corchorus olitorius] Length = 376 Score = 67.4 bits (163), Expect = 2e-10 Identities = 30/37 (81%), Positives = 35/37 (94%) Frame = +1 Query: 1 IDEANPKRYMDTDFDSFLTYVSTREPKKKDFLESRKL 111 IDEANP+RYMDTDF +FL Y+S+REPKKK+FLESRKL Sbjct: 339 IDEANPRRYMDTDFATFLEYISSREPKKKNFLESRKL 375 >ref|NP_001241598.1| uncharacterized protein LOC100778488 [Glycine max] gb|ACU20813.1| unknown [Glycine max] gb|KHN02284.1| Putative 2-oxoglutarate/Fe(II)-dependent dioxygenase [Glycine soja] gb|KRG96078.1| hypothetical protein GLYMA_19G188100 [Glycine max] Length = 375 Score = 66.6 bits (161), Expect = 4e-10 Identities = 29/38 (76%), Positives = 34/38 (89%) Frame = +1 Query: 1 IDEANPKRYMDTDFDSFLTYVSTREPKKKDFLESRKLI 114 +DEANPKRYMDTDF +FL YVS+ EP KKDFLESRK++ Sbjct: 337 VDEANPKRYMDTDFGTFLAYVSSTEPNKKDFLESRKVL 374 >ref|XP_017409994.1| PREDICTED: protein DMR6-LIKE OXYGENASE 2-like [Vigna angularis] gb|KOM29251.1| hypothetical protein LR48_Vigan641s003900 [Vigna angularis] dbj|BAT85781.1| hypothetical protein VIGAN_04336700 [Vigna angularis var. angularis] Length = 373 Score = 65.9 bits (159), Expect = 7e-10 Identities = 29/38 (76%), Positives = 34/38 (89%) Frame = +1 Query: 1 IDEANPKRYMDTDFDSFLTYVSTREPKKKDFLESRKLI 114 +DE NPKRYMDTDF +FL YVS++EP KKDFLESRKL+ Sbjct: 336 VDEDNPKRYMDTDFATFLAYVSSQEPNKKDFLESRKLL 373 >ref|XP_007162817.1| hypothetical protein PHAVU_001G183300g [Phaseolus vulgaris] gb|ESW34811.1| hypothetical protein PHAVU_001G183300g [Phaseolus vulgaris] Length = 374 Score = 65.9 bits (159), Expect = 7e-10 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = +1 Query: 4 DEANPKRYMDTDFDSFLTYVSTREPKKKDFLESRKL 111 DEANPKRYMDTDF +FL YVS+ EP KKDFLESRKL Sbjct: 338 DEANPKRYMDTDFATFLAYVSSHEPNKKDFLESRKL 373 >ref|XP_012567886.1| PREDICTED: probable 2-oxoglutarate/Fe(II)-dependent dioxygenase, partial [Cicer arietinum] Length = 138 Score = 62.4 bits (150), Expect = 1e-09 Identities = 28/36 (77%), Positives = 32/36 (88%) Frame = +1 Query: 1 IDEANPKRYMDTDFDSFLTYVSTREPKKKDFLESRK 108 IDEANPKRY+DTDF++FL YVST E K+K FLESRK Sbjct: 96 IDEANPKRYVDTDFETFLAYVSTTETKRKSFLESRK 131 >ref|XP_020239054.1| protein DMR6-LIKE OXYGENASE 1-like [Cajanus cajan] gb|KYP42936.1| Protein SRG1 [Cajanus cajan] Length = 373 Score = 64.7 bits (156), Expect = 2e-09 Identities = 28/37 (75%), Positives = 34/37 (91%) Frame = +1 Query: 1 IDEANPKRYMDTDFDSFLTYVSTREPKKKDFLESRKL 111 IDE NPKRY DT+FD+FL YV+TREPK+K+FL+SRKL Sbjct: 332 IDEENPKRYADTNFDTFLAYVTTREPKRKEFLDSRKL 368 >ref|XP_014495649.1| protein DMR6-LIKE OXYGENASE 2 [Vigna radiata var. radiata] ref|XP_022634697.1| protein DMR6-LIKE OXYGENASE 2 [Vigna radiata var. radiata] Length = 373 Score = 64.7 bits (156), Expect = 2e-09 Identities = 28/38 (73%), Positives = 34/38 (89%) Frame = +1 Query: 1 IDEANPKRYMDTDFDSFLTYVSTREPKKKDFLESRKLI 114 +DE NPKRYMDTDF +FL YVS++EP KKDFL+SRKL+ Sbjct: 336 VDEDNPKRYMDTDFATFLAYVSSQEPNKKDFLDSRKLL 373 >ref|XP_014513105.1| protein DMR6-LIKE OXYGENASE 1 isoform X2 [Vigna radiata var. radiata] Length = 380 Score = 64.7 bits (156), Expect = 2e-09 Identities = 28/37 (75%), Positives = 34/37 (91%) Frame = +1 Query: 1 IDEANPKRYMDTDFDSFLTYVSTREPKKKDFLESRKL 111 ID+ NPKRY DT+FD+FL YV+TREPK+KDFL+SRKL Sbjct: 333 IDQHNPKRYADTNFDTFLAYVTTREPKRKDFLDSRKL 369 >ref|XP_017414293.1| PREDICTED: protein DMR6-LIKE OXYGENASE 1-like [Vigna angularis] gb|KOM34587.1| hypothetical protein LR48_Vigan02g073700 [Vigna angularis] dbj|BAT96041.1| hypothetical protein VIGAN_08291100 [Vigna angularis var. angularis] Length = 380 Score = 64.7 bits (156), Expect = 2e-09 Identities = 28/37 (75%), Positives = 34/37 (91%) Frame = +1 Query: 1 IDEANPKRYMDTDFDSFLTYVSTREPKKKDFLESRKL 111 ID+ NPKRY DT+FD+FL YV+TREPK+KDFL+SRKL Sbjct: 333 IDQHNPKRYADTNFDTFLAYVTTREPKRKDFLDSRKL 369