BLASTX nr result
ID: Astragalus23_contig00022156
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus23_contig00022156 (1479 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003590171.1| transmembrane protein, putative [Medicago tr... 58 5e-06 >ref|XP_003590171.1| transmembrane protein, putative [Medicago truncatula] gb|AES60422.1| transmembrane protein, putative [Medicago truncatula] Length = 209 Score = 58.2 bits (139), Expect = 5e-06 Identities = 39/106 (36%), Positives = 51/106 (48%) Frame = +2 Query: 773 SNLCWVLYALKMFDEMPLPSQIFCLHFLCVVSLVSYPNLYTSPNFQWKLDCWICKGKFET 952 S LC+V+ A K+F +MP F +C V+ NLY Q + FET Sbjct: 102 SCLCFVMVAQKLFVKMPQWCWTFWTRVMCAYLKVAANNLYLFSTKQMDSKFVVSLTNFET 161 Query: 953 AYSRISPLEAKDLIRNWIGKKTVVPHILLALIHGRKKLLSWVADYR 1090 YSR + K++I NWI KKTV H RKKL+ WV +R Sbjct: 162 TYSRYVLAKVKEMILNWIDKKTVDLLFSFVNDHLRKKLV-WVIGFR 206